NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5504.1 Public Homo sapiens 7 IGFBP1 20 108 85 CCDS HistoryNCBI Gene:3484Re-query CCDS DB by CCDS ID:5504.1Re-query CCDS DB by GeneID:3484See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000275525 ENSP00000275525 Accepted alive Link to Ensembl Transcript Viewer:ENST00000275525Link to Ensembl Protein Viewer:ENSP00000275525Re-query CCDS DB by Nucleotide ID:ENST00000275525Re-query CCDS DB by Protein ID:ENSP00000275525
Original member Current member EBI,WTSI OTTHUMT00000251355 OTTHUMP00000159561 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251355Link to Vega Protein Viewer:OTTHUMP00000159561Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251355Re-query CCDS DB by Protein ID:OTTHUMP00000159561
Original member Current member NCBI NM_000596.2 NP_000587.1 Accepted alive Link to Nucleotide Sequence:NM_000596.2Link to Protein Sequence:NP_000587.1Re-query CCDS DB by Nucleotide ID:NM_000596Re-query CCDS DB by Protein ID:NP_000587Link to BLink:NP_000587.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000587.1 259 P08833 259 100% 0 0

Chromosomal Locations for CCDS 5504.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 45888653 45889001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45890548 45890717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45891932 45892060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45892960 45893091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (780 nt):
ATGTCAGAGGTCCCCGTTGCTCGCGTCTGGCTGGTACTGCTCCTGCTGACTGTCCAGGTCGGCGTGACAG
CC
GGCGCTCCGTGGCAGTGCGCGCCCTGCTCCGCCGAGAAGCTCGCGCTCTGCCCGCCGGTGTCCGCCTC
G
TGCTCGGAGGTCACCCGGTCCGCCGGCTGCGGCTGTTGCCCGATGTGCGCCCTGCCTCTGGGCGCCGCG
TGC
GGCGTGGCGACTGCACGCTGCGCCCGGGGACTCAGTTGCCGCGCGCTGCCGGGGGAGCAGCAACCTC
TG
CACGCCCTCACCCGCGGCCAAGGCGCCTGCGTGCAGGAGTCTGACGCCTCCGCTCCCCATGCTGCAGA
G
GCAGGGAGCCCTGAAAGCCCAGAGAGCACGGAGATAACTGAGGAGGAGCTCCTGGATAATTTCCATCTG
ATG
GCCCCTTCTGAAGAGGATCATTCCATCCTTTGGGACGCCATCAGTACCTATGATGGCTCGAAGGCTC
TC
CATGTCACCAACATCAAAAAATGGAAGGAGCCCTGCCGAATAGAACTCTACAGAGTCGTAGAGAGTTT
A
GCCAAGGCACAGGAGACATCAGGAGAAGAAATTTCCAAATTTTACCTGCCAAACTGCAACAAGAATGGA
TTT
TATCACAGCAGACAGTGTGAGACATCCATGGATGGAGAGGCGGGACTCTGCTGGTGCGTCTACCCTT
GG
AATGGGAAGAGGATCCCTGGGTCTCCAGAGATCAGGGGAGACCCCAACTGCCAGATATATTTTAATGT
A
CAAAACTGA


Translation (259 aa):
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAA
C
GVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAA
EAGSPESPESTEITEEELLDNFHL
M
APSEEDHSILWDAISTYDGSKALHVTNIKKWK
EPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNG
F
YHSRQ
CETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser