NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1151.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1151.1 Public Homo sapiens 1 NES 20 108 85 CCDS HistoryNCBI Gene:10763Re-query CCDS DB by CCDS ID:1151.1Re-query CCDS DB by GeneID:10763See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1151.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000368223 ENSP00000357206 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368223Link to Ensembl Protein Viewer:ENSP00000357206Re-query CCDS DB by Nucleotide ID:ENST00000368223Re-query CCDS DB by Protein ID:ENSP00000357206
Original member Current member EBI,WTSI OTTHUMT00000082844 OTTHUMP00000032198 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000082844Link to Vega Protein Viewer:OTTHUMP00000032198Re-query CCDS DB by Nucleotide ID:OTTHUMT00000082844Re-query CCDS DB by Protein ID:OTTHUMP00000032198
Original member Current member NCBI NM_006617.1 NP_006608.1 Accepted alive Link to Nucleotide Sequence:NM_006617.1Link to Protein Sequence:NP_006608.1Re-query CCDS DB by Nucleotide ID:NM_006617Re-query CCDS DB by Protein ID:NP_006608Link to BLAST:NP_006608.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006608.1 1621 P48681 1621 100% 0 0

Chromosomal Locations for CCDS 1151.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 156669322 156673205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 156673454 156673527 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 156675216 156675340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 156676482 156677264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4866 nt):
ATGGAGGGCTGCATGGGGGAGGAGTCGTTTCAGATGTGGGAGCTCAATCGGCGCCTGGAGGCCTACCTGG
CC
CGGGTCAAGGCGCTGGAGGAGCAGAATGAGCTGCTCAGCGCGGAGCTCGGGGGGCTCCGGGCACAATC
C
GCGGACACCTCCTGGCGGGCGCATGCCGACGACGAGCTGGCGGCCCTGCGGGCCCTCGTTGACCAACGC
TGG
CGGGAGAAGCACGCGGCCGAGGTGGCGCGCGACAACCTGGCTGAAGAGCTGGAGGGCGTGGCAGGCC
GA
TGCCAGCAGCTGCGGCTGGCCCGGGAGCGGACGACGGAGGAGGTAGCCCGCAACCGGCGCGCCGTCGA
G
GCAGAGAAATGCGCCCGGGCCTGGCTGAGTAGCCAGGTGGCAGAGCTGGAGCGCGAGCTAGAGGCTCTA
CGC
GTGGCGCACGAGGAGGAGCGCGTCGGCCTGAACGCGCAGGCTGCCTGTGCCCCCCGCTGCCCCGCGC
CG
CCCCGCGGGCCTCCCGCGCCGGCCCCGGAGGTAGAGGAGCTGGCAAGGCGACTGGGCGAGGCGTGGCG
C
GGGGCAGTGCGCGGCTACCAGGAGCGCGTGGCACACATGGAGACGTCGCTGGGCCAGGCCCGCGAGCGG
CTG
GGCCGGGCGGTGCAGGGTGCCCGCGAGGGCCGCCTGGAGCTGCAGCAGCTCCAGGCTGAGCGCGGAG
GC
CTCCTGGAGCGCAGGGCAGCGTTGGAACAGAGGTTGGAGGGCCGCTGGCAGGAGCGGCTGCGGGCTAC
T
GAAAAGTTCCAGCTGGCTGTGGAGGCCCTGGAGCAGGAGAAACAGGGCCTACAGAGCCAGATCGCTCAG
GTC
CTGGAAGGTCGGCAGCAGCTGGCGCACCTCAAGATGTCCCTCAGCCTGGAGGTGGCCACGTACAGGA
CC
CTCCTGGAGGCTGAGAACTCCCGGCTGCAAACACCTGGCGGTGGCTCCAAGACTTCCCTCAGCTTTCA
G
GACCCCAAGCTGGAGCTGCAATTCCCTAGGACCCCAGAGGGCCGGCGTCTTGGATCTTTGCTCCCAGTC
CTG
AGCCCAACTTCCCTCCCCTCACCCTTGCCTGCTACCCTTGAGACACCTGTGCCAGCCTTTCTTAAGA
AC
CAAGAATTCCTCCAGGCCCGTACCCCTACCTTGGCCAGCACCCCCATCCCCCCCACACCTCAGGCACC
C
TCTCCTGCTGTAGATGCAGAGATCAGAGCCCAGGATGCTCCTCTCTCTCTGCTCCAGACACAGGGTGGG
AGG
AAACAGGCTCCAGAGCCCCTGCGGGCTGAAGCCAGGGTGGCCATTCCTGCCAGCGTCCTGCCTGGAC
CA
GAGGAGCCTGGGGGCCAGCGGCAAGAGGCCAGTACAGGCCAGTCCCCAGAGGACCATGCCTCCTTGGC
A
CCACCCCTCAGCCCTGACCACTCCAGTTTAGAGGCTAAGGATGGAGAATCCGGTGGGTCTAGAGTGTTC
AGC
ATATGCCGAGGGGAAGGTGAAGGGCAAATCTGGGGGTTGGTAGAGAAAGAAACAGCCATAGAGGGCA
AA
GTGGTAAGCAGCTTGCAGCAGGAAATATGGGAAGAAGAGGATCTAAACAGGAAGGAAATCCAGGACTC
C
CAGGTTCCTTTGGAAAAAGAAACCCTGAAGTCTCTGGGAGAGGAGATTCAAGAGTCACTGAAGACTCTG
GAA
AACCAGAGCCATGAGACACTAGAAAGGGAGAATCAAGAATGTCCGAGGTCTTTAGAAGAAGACTTAG
AA
ACACTAAAAAGTCTAGAAAAGGAAAATAAAGAGCTATTAAAGGATGTGGAGGTAGTGAGACCTCTAGA
A
AAAGAGGCTGTAGGCCAACTTAAGCCTACAGGAAAAGAGGACACACAGACATTGCAATCCCTGCAAAAG
GAG
AATCAAGAACTAATGAAATCTCTTGAAGGTAATCTAGAGACATTTTTATTTCCAGGAACGGAAAATC
AA
GAATTAGTAAGTTCTCTGCAAGAGAACTTAGAGTCATTGACAGCTCTGGAAAAGGAGAATCAAGAGCC
A
CTGAGATCTCCAGAAGTAGGGGATGAGGAGGCACTGAGACCTCTGACAAAGGAGAATCAGGAACCCCTG
AGG
TCTCTTGAAGATGAGAACAAAGAGGCCTTTAGATCTCTAGAAAAAGAGAACCAGGAGCCACTGAAGA
CT
CTAGAAGAAGAGGACCAGAGTATTGTGAGACCTCTAGAAACAGAGAATCACAAATCACTGAGGTCTTT
A
GAAGAACAGGACCAAGAGACATTGAGAACTCTTGAAAAAGAGACTCAACAGCGACGGAGGTCTCTAGGG
GAA
CAGGATCAGATGACATTAAGACCCCCAGAAAAAGTGGATCTAGAACCACTGAAGTCTCTTGACCAGG
AG
ATAGCTAGACCTCTTGAAAATGAGAATCAAGAGTTCTTAAAGTCACTCAAAGAAGAGAGCGTAGAGGC
A
GTAAAATCTTTAGAAACAGAGATCCTAGAATCACTGAAGTCTGCGGGACAAGAGAACCTGGAAACACTG
AAA
TCTCCAGAAACTCAAGCACCACTGTGGACTCCAGAAGAAATAAATCAGGGGGCAATGAATCCTCTAG
AA
AAGGAAATTCAAGAACCACTGGAGTCTGTGGAAGTGAACCAAGAGACATTCAGACTCCTGGAAGAGGA
G
AATCAGGAATCATTGAGATCTCTGGGAGCATGGAACCTGGAGAATTTGAGATCTCCAGAGGAGGTAGAC
AAG
GAAAGTCAAAGGAATCTGGAAGAGGAAGAGAACCTGGGAAAGGGAGAGTACCAAGAGTCACTGAGGT
CT
CTGGAGGAGGAGGGACAGGAGCTGCCGCAGTCTGCAGATGTGCAGAGGTGGGAAGATACGGTGGAGAA
G
GACCAAGAACTGGCTCAGGAAAGCCCTCCTGGGATGGCTGGAGTGGAAAATGAGGATGAGGCAGAGCTG
AAT
CTGAGGGAGCAGGATGGCTTCACTGGGAAGGAGGAGGTGGTAGAGCAGGGAGAGCTGAATGCCACAG
AG
GAGGTCTGGATCCCAGGCGAGGGGCACCCAGAGAGCCCTGAGCCCAAAGAGCAGAGAGGCCTGGTTGA
G
GGAGCCAGTGTGAAGGGAGGGGCTGAGGGCCTCCAGGACCCTGAAGGGCAATCACAACAGGTGGGGGCC
CCA
GGCCTCCAGGCTCCCCAGGGGCTGCCAGAGGCGATAGAGCCCCTGGTGGAAGATGATGTGGCCCCAG
GG
GGTGACCAAGCCTCCCCAGAGGTCATGTTGGGGTCAGAGCCTGCCATGGGTGAGTCTGCTGCGGGAGC
T
GAGCCAGGCCCGGGGCAGGGGGTGGGAGGGCTGGGGGACCCAGGCCATCTGACCAGGGAAGAGGTGATG
GAA
CCACCCCTGGAAGAGGAGAGTTTGGAGGCAAAGAGGGTTCAGGGCTTGGAAGGGCCTAGAAAGGACC
TA
GAGGAGGCAGGTGGTCTGGGGACAGAGTTCTCCGAGCTGCCTGGGAAGAGCAGAGACCCTTGGGAGCC
T
CCCAGGGAGGGTAGGGAGGAGTCAGAGGCTGAGGCCCCCAGGGGAGCAGAGGAGGCGTTCCCTGCTGAG
ACC
CTGGGCCACACTGGAAGTGATGCCCCTTCACCTTGGCCTCTGGGGTCAGAGGAAGCTGAGGAGGATG
TA
CCACCAGTGCTGGTCTCCCCCAGCCCAACGTACACCCCGATCCTGGAAGATGCCCCTGGGCCTCAGCC
T
CAGGCTGAAGGGAGTCAGGAGGCTAGCTGGGGGGTGCAGGGGAGGGCTGAAGCCCTGGGGAAAGTAGAG
AGC
GAGCAGGAGGAGTTGGGTTCTGGGGAGATCCCCGAGGGCCCCCAGGAGGAAGGGGAGGAGAGCAGAG
AA
GAGAGCGAGGAGGATGAGCTCGGGGAGACCCTTCCAGACTCCACTCCCCTGGGCTTCTACCTCAGGTC
C
CCCACCTCCCCCAGGTGGGACCCCACTGGAGAGCAGAGGCCACCCCCTCAAGGGGAGACTGGAAAGGAG
GGC
TGGGATCCTGCTGTCCTGGCTTCCGAGGGCCTTGAGGCCCCACCCTCAGAAAAGGAGGAGGGGGAGG
AG
GGAGAAGAGGAGTGTGGCCGTGACTCTGACCTGTCAGAAGAATTTGAGGACCTGGGGACTGAGGCACC
T
TTTCTTCCTGGGGTCCCTGGGGAGGTGGCAGAACCTCTGGGCCAGGTGCCCCAGCTGCTACTGGATCCT
GCA
GCCTGGGATCGAGATGGGGAGTCCGATGGGTTTGCAGATGAGGAAGAAAGTGGGGAGGAGGGAGAGG
AG
GATCAGGAGGAGGGGAGGGAGCCAGGGGCTGGGCGGTGGGGGCCAGGGTCTTCTGTTGGCAGCCTCCA
G
GCCCTGAGTAGCTCCCAGAGAGGGGAATTCCTGGAGTCTGATTCTGTGAGTGTCAGTGTCCCCTGGGAT
GAC
AGCTTGAGGGGTGCAGTGGCTGGTGCCCCCAAGACTGCCCTGGAAACGGAGTCCCAGGACAGTGCTG
AG
CCTTCTGGCTCAGAGGAAGAGTCTGACCCTGTTTCCTTGGAGAGGGAGGACAAAGTCCCTGGCCCTCT
A
GAGATCCCCAGTGGGATGGAGGATGCAGGCCCAGGGGCAGACATCATTGGTGTTAATGGCCAGGGTCCC
AAC
TTGGAGGGGAAGTCACAGCATGTGAATGGGGGAGTGATGAACGGGCTGGAGCAGTCTGAGGAAGTGG
GG
CAAGGAATGCCGCTAGTCTCTGAGGGAGACCGAGGGAGCCCCTTTCAGGAGGAGGAGGGGAGTGCTCT
G
AAGACCTCTTGGGCAGGGGCTCCTGTTCACCTGGGCCAGGGTCAGTTCCTGAAGTTCACTCAGAGGGAA
GGA
GATAGAGAGTCCTGGTCCTCAGGGGAGGACTAG


Translation (1621 aa):
MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDELAALRALVDQR
W
REKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEKCARAWLSSQVAELERELEAL
R
VAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLGQARER
L
GRAVQGAREGRLELQQLQAERGGLLERRAALEQRLEGRWQERLRATEKFQ
LAVEALEQEKQGLQSQIAQ
V
LEGRQQLAHLKMSLSLEVATY
RTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPV
L
SPTSLPSPLPATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG
R
KQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAKDGESGGSRVF
S
ICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVPLEKETLKSLGEEIQESLKTL
E
NQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDVEVVRPLEKEAVGQLKPTGKEDTQTLQSLQK
E
NQELMKSLEGNLETFLFPGTENQELVSSLQENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPL
R
SLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLG
E
QDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL
K
SPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNLENLRSPEEVD
K
ESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQELAQESPPGMAGVENEDEAEL
N
LREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPKEQRGLVEGASVKGGAEGLQDPEGQSQQVGA
P
GLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVM
E
PPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAE
T
LGHTGSDAPSPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE
S
EQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKE
G
WDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLPGVPGEVAEPLGQVPQLLLDP
A
AWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPGSSVGSLQALSSSQRGEFLESDSVSVSVPWD
D
SLRGAVAGAPKTALETESQDSAEPSGSEEESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGP
N
LEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQRE
G
DRESWSSGED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser