NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21372.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21372.1 Public Mus musculus 7 Ntrk3 21 106 86 CCDS HistoryNCBI Gene:18213Re-query CCDS DB by CCDS ID:21372.1Re-query CCDS DB by GeneID:18213See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21372.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039438 ENSMUSP00000038324 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039438Link to Ensembl Protein Viewer:ENSMUSP00000038324Re-query CCDS DB by Nucleotide ID:ENSMUST00000039438Re-query CCDS DB by Protein ID:ENSMUSP00000038324
Original member Current member EBI,WTSI OTTMUST00000050043 OTTMUSP00000023301 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000050043Link to Vega Protein Viewer:OTTMUSP00000023301Re-query CCDS DB by Nucleotide ID:OTTMUST00000050043Re-query CCDS DB by Protein ID:OTTMUSP00000023301
Original member Current member NCBI NM_182809.2 NP_877961.1 Accepted alive Link to Nucleotide Sequence:NM_182809.2Link to Protein Sequence:NP_877961.1Re-query CCDS DB by Nucleotide ID:NM_182809Re-query CCDS DB by Protein ID:NP_877961Link to BLAST:NP_877961.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_877961.1 612 Q6VNS1-3 612 100% 0 0

Chromosomal Locations for CCDS 21372.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 78302629 78302747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78304292 78304426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78356027 78356215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78450887 78450989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78451891 78451955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78453323 78453346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78460281 78460577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78461045 78461186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78461586 78461728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78462785 78462942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78477864 78477932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78516729 78516800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78517419 78517493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 78577536 78577783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1839 nt):
ATGGATGTCTCTCTTTGCCCAGCCAAGTGTAGTTTCTGGCGGATTTTCTTGCTGGGAAGCGTCTGGCTGG
AC
TATGTGGGCTCCGTGCTGGCTTGCCCTGCAAATTGTGTCTGCAGCAAGACTGAGATCAATTGCCGGCG
G
CCGGACGATGGGAACCTCTTCCCTCTCCTGGAAGGGCAGGATTCAGGGAACAGCAATGGGAACGCCAGC
ATC
AACATTACGGACATCTCAAGGAATATCACTTCCATACACATAGAGAACTGGCGAGGCCTGCACACAC
TC
AATGCTGTGGACATGGAGCTCTACACGGGACTCCAGAAGCTGACCATCAAGAATTCTGGACTCCGGAA
C
ATCCAGCCCAGAGCCTTCGCCAAGAACCCCCACTTGCGTTATATAAACTTGTCAAGTAACCGGCTCACC
ACA
CTCTCCTGGCAGCTCTTCCAGACGCTGAGCCTTCGGGAATTGAGACTGGAGCAGAACTTCTTCAACT
GC
AGCTGTGACATCCGCTGGATGCAGCTGTGGCAGGAACAGGGGGAGGCGCGGCTGGACAGCCAGAGCCT
T
TACTGCATCAGTGCTGATGGCTCCCAACTCCCCCTCTTCCGCATGAACATCAGTCAGTGTGATCTCCCA
GAG
ATCAGTGTGAGCCACGTCAACCTGACTGTCCGAGAAGGAGACAATGCCGTGATCACTTGCAATGGCT
CT
GGCTCTCCTTTGCCTGATGTGGACTGGATAGTCACTGGGCTGCAGTCCATCAACACCCACCAGACCAA
T
CTGAACTGGACCAATGTACATGCCATCAACTTGACCCTGGTGAACGTGACGAGCGAGGACAATGGCTTC
ACC
CTGACGTGCATTGCAGAGAACGTGGTGGGCATGAGCAATGCCAGTGTTGCTCTCACTGTCTACTACC
CT
CCACGTGTGGTGAGCCTGGTGGAGCCTGAGGTACGCCTGGAACATTGCATTGAGTTTGTGGTGCGTGG
C
AACCCGACACCCACGCTCCACTGGCTGTACAATGGACAGCCATTGAGGGAGTCCAAGATCATTCACATG
GAC
TACTACCAGGAGGGGGAGGTCTCAGAGGGCTGCCTGCTCTTCAACAAGCCCACCCACTACAACAATG
GC
AACTACACCCTCATTGCTAAGAATGCCCTGGGCACGGCCAACCAGACCATCAACGGCCACTTCCTGAA
G
GAGCCCTTTCCAGAGAGCACAGATTTCTTTGACTTTGAGTCTGATGCGAGCCCTACACCTCCTATCACT
GTG
ACCCACAAACCAGAGGAAGACACTTTTGGGGTGTCCATAGCAGTCGGACTTGCTGCCTTTGCCTGCG
TC
CTTCTGGTGGTTCTCTTTATCATGATCAACAAGTATGGTCGCCGGTCCAAATTTGGAATGAAGGGTCC
T
GTGGCTGTTATCAGTGGAGAGGAGGACTCAGCCAGCCCACTGCATCACATCAACCATGGCATCACTACA
CCA
TCATCGTTGGATGCTGGGCCTGACACAGTGGTCATTGGCATGACCCGCATCCCAGTCATTGAGAACC
CC
CAGTACTTCCGTCAGGGTCACAATTGCCACAAGCCAGACACATGGGTCTTTTCAAACATAGACAATCA
T
GGGATATTAAACTTGAAGGACAATAGAGATCATCTAGTCCCATCAACTCACTATATATATGAGGAACCT
GAG
GTCCAGAGTGGGGATGTGTCTTACCCAAGGTCACATGGTTTCAGAGAAATTATGTTGAATCCAATAA
GC
CTTTCCGGACATTCCAAGCCTCTTAACCATGGCATCTATGTTGAGGATGTCAATGTTTATTTCAGCAA
A
GGACGTCATGGCTTTTAA


Translation (612 aa):
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS
I
NITDISRNITS
IHIENWRGLHTLNAVDMELYTGLQKLTIKNSGLRNIQPRAFAKNPHLRYINLSSNRLT
T
LSWQLFQTLSLRE
LRLEQNFFNCSCDIRWMQLWQEQGEARLDSQSLYCISADGSQLPLFRMNISQCDLP
E
ISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQ
TNLNWTNVHAINLTLVNVTSEDNGF
T
LTCIAENVVGMSNASVALTVY
YPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHM
D
YYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFP
ESTDFFDFESDASPTPPIT
V
THKPEEDTFG
VSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT
P
SSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDT
WVFSNIDNHGILNLKDNRDHLVPSTHYIYEEP
E
VQSGDVSYPRSH
GFREIMLNPISLSGHSKPLNHGIYVEDVNVYFSKGRHGF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser