NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10099.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10099.1 Public Homo sapiens 15 CATSPER2 20 108 85 CCDS HistoryNCBI Gene:117155Re-query CCDS DB by CCDS ID:10099.1Re-query CCDS DB by GeneID:117155See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10099.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000321596 ENSP00000321463 Accepted alive Link to Ensembl Transcript Viewer:ENST00000321596Link to Ensembl Protein Viewer:ENSP00000321463Re-query CCDS DB by Nucleotide ID:ENST00000321596Re-query CCDS DB by Protein ID:ENSP00000321463
Original member Current member EBI,WTSI OTTHUMT00000133151 OTTHUMP00000066277 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000133151Link to Vega Protein Viewer:OTTHUMP00000066277Re-query CCDS DB by Nucleotide ID:OTTHUMT00000133151Re-query CCDS DB by Protein ID:OTTHUMP00000066277
Original member NCBI NM_172095.2 NP_742093.1 Updated not alive Link to Nucleotide Sequence:NM_172095.2Link to Protein Sequence:NP_742093.1Re-query CCDS DB by Nucleotide ID:NM_172095Re-query CCDS DB by Protein ID:NP_742093
Current member NCBI NM_172095.3 NP_742093.1 Accepted alive Link to Nucleotide Sequence:NM_172095.3Link to Protein Sequence:NP_742093.1Re-query CCDS DB by Nucleotide ID:NM_172095Re-query CCDS DB by Protein ID:NP_742093Link to BLAST:NP_742093.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_742093.1 530 Q96P56-1 530 100% 0 0

Chromosomal Locations for CCDS 10099.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 43630701 43630732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43632199 43632363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43632717 43632934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43635360 43635416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43635727 43635826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43636041 43636219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43638904 43639028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43639643 43639798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43640324 43640496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43647050 43647118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43647294 43647467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 43647917 43648061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1593 nt):
ATGGCCGCTTACCAACAAGAAGAGCAGATGCAGCTTCCCCGAGCTGATGCCATTCGTTCACGTCTCATCG
AT
ACTTTCTCTCTCATTGAGCATTTGCAAGGCTTGAGCCAAGCTGTGCCGCGGCACACTATCAGGGAGTT
A
CTTGATCCTTCCCGCCAGAAGAAACTTGTATTGGGAGATCAACACCAGCTAGTGCGTTTCTCTATAAAG
CCT
CAGCGTATAGAACAGATTTCACATGCCCAGAGGCTGTTGAGCAGGCTTCATGTGCGCTGCAGTCAGA
GG
CCACCTCTTTCTTTGTGGGCCGGATGGGTCCTTGAGTGTCCTCTCTTCAAAAACTTCATCATCTTCCT
G
GTCTTTTTGAATACGATCATATTGATGGTTGAAATAGAATTGCTGGAATCCACAAATACCAAACTATGG
CCA
TTGAAGCTGACCTTGGAGGTGGCAGCTTGGTTTATCTTGCTTATTTTCATCCTGGAGATCCTTCTTA
AG
TGGCTATCCAACTTTTCTGTTTTCTGGAAGAGTGCCTGGAATGTCTTTGACTTTGTTGTTACCATGTT
G
TCCCTGCTTCCCGAGGTTGTGGTATTGGTAGGGGTAACAGGCCAATCGGTGTGGCTTCAGCTTCTGAGG
ATC
TGCCGGGTGCTGAGGTCTCTCAAACTCCTTGCACAATTCCGTCAAATTCAAATTATTATTTTGGTCC
TG
GTCAGGGCCCTCAAGAGCATGACCTTCCTCTTGATGTTGCTGCTCATCTTCTTCTACATTTTTGCTGT
G
ACTGGTGTCTACGTCTTCTCAGAGTACACCCGTTCACCTCGTCAGGACCTGGAGTACCATGTGTTCTTC
TC
G
GACCTCCCGAATTCCCTGGTAACAGTGTTCATTCTCTTCACCTTGGATCATTGGTATGCACTGCTTC
AG
GACGTCTGGAAGGTGCCTGAAGTCAGTCGCATCTTCAGCAGCATCTATTTCATCCTTTGGTTGTTGCT
T
GGCTCCATTATCTTTCGAAGTATCATAGTAGCCATGATGGTTACTAACTTTCAGAATATCAGGAAAGAG
CTG
AATGAGGAGATGGCGCGTCGGGAGGTTCAGCTCAAAGCTGACATGTTCAAGCGGCAGATCATCCAGA
G
G
AGAAAAAACATGTCACATGAAGCACTGACGTCAAGCCATAGCAAAATAGAGGACAGTTCAAGAGGAGC
T
AGTCAACAAAGGGAAAGTTTGGACTTATCAGAAGTGTCTGAAGTAGAGTCTAATTATGGTGCCACTGAA
GAG
GATTTAATAACATCTGCATCAAAAACAGAAGAGACCTTGTCAAAAAAGAGAGAGTACCAGTCTTCCT
CC
TGTGTCTCCTCCACATCCTCTTCCTATTCTTCCTCTTCTGAATCCAGATTTTCTGAATCTATTGGTCG
T
TTGGACTGGGAGACTCTTGTGCACGAAAATCTGCCCGGGCTAATGGAAATGGATCAGGATGACCGTGTT
TGG
CCCAGAGACTCACTCTTCCGATATTTTGAGTTGCTAGAAAAGCTTCAGTATAACCTAGAGGAACGTA
AG
AAGTTACAAGAGTTTGCAGTGCAGGCACTGATGAACTTGGAAGACAAGTAA


Translation (530 aa):
MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK
P
QRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLE
CPLFKNFIIFLVFLNTIILMVEIELLESTNTKLW
P
LKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVFDFVVTML
SLLPEVVVLVGVTGQSVWLQLLR
I
CRVLRSLKLLAQFRQIQIIILVLVRALK
SMTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFF
S
DLPNSLVTVFILFTLDHWYALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKE
L
NEEMARREVQLKADMFKRQIIQ
RRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE
E
DLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESI
GRLDWETLVHENLPGLMEMDQDDRV
W
PRDSLFRYFELLEKLQYNLEERKKLQEFA
VQALMNLEDK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser