NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32656.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32656.1 Public Homo sapiens 17 STAT3 20 108 85 CCDS HistoryNCBI Gene:6774Re-query CCDS DB by CCDS ID:32656.1Re-query CCDS DB by GeneID:6774See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32656.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000264657 ENSP00000264657 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264657Link to Ensembl Protein Viewer:ENSP00000264657Re-query CCDS DB by Nucleotide ID:ENST00000264657Re-query CCDS DB by Protein ID:ENSP00000264657
Original member Current member EBI,WTSI ENST00000588969 ENSP00000467985 Accepted alive Link to Ensembl Transcript Viewer:ENST00000588969Link to Ensembl Protein Viewer:ENSP00000467985Re-query CCDS DB by Nucleotide ID:ENST00000588969Re-query CCDS DB by Protein ID:ENSP00000467985
Original member Current member EBI,WTSI OTTHUMT00000319353 OTTHUMP00000198123 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000319353Link to Vega Protein Viewer:OTTHUMP00000198123Re-query CCDS DB by Nucleotide ID:OTTHUMT00000319353Re-query CCDS DB by Protein ID:OTTHUMP00000198123
Original member Current member EBI,WTSI OTTHUMT00000449932 OTTHUMP00000263435 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000449932Link to Vega Protein Viewer:OTTHUMP00000263435Re-query CCDS DB by Nucleotide ID:OTTHUMT00000449932Re-query CCDS DB by Protein ID:OTTHUMP00000263435
Original member Current member NCBI NM_139276.2 NP_644805.1 Accepted alive Link to Nucleotide Sequence:NM_139276.2Link to Protein Sequence:NP_644805.1Re-query CCDS DB by Nucleotide ID:NM_139276Re-query CCDS DB by Protein ID:NP_644805Link to BLAST:NP_644805.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_644805.1 770 P40763-1 770 100% 0 0

Chromosomal Locations for CCDS 32656.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 42315745 42315800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42316789 42316901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42317182 42317224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42322282 42322494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42323004 42323143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42323260 42323354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42323573 42323625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42324711 42324846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42324963 42325061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42326116 42326199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42329410 42329457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42329554 42329647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42329747 42329776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42331472 42331531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42333673 42333765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42333891 42334049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42337435 42337586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42337763 42337857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42338731 42338812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42339314 42339409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42345559 42345657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42346569 42346713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42348389 42348516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2313 nt):
ATGGCCCAATGGAATCAGCTACAGCAGCTTGACACACGGTACCTGGAGCAGCTCCATCAGCTCTACAGTG
AC
AGCTTCCCAATGGAGCTGCGGCAGTTTCTGGCCCCTTGGATTGAGAGTCAAGATTGGGCATATGCGGC
C
AGCAAAGAATCACATGCCACTTTGGTGTTTCATAATCTCCTGGGAGAGATTGACCAGCAGTATAGCCGC
TTC
CTGCAAGAGTCGAATGTTCTCTATCAGCACAATCTACGAAGAATCAAGCAGTTTCTTCAGAGCAGGT
AT
CTTGAGAAGCCAATGGAGATTGCCCGGATTGTGGCCCGGTGCCTGTGGGAAGAATCACGCCTTCTACA
G
ACTGCAGCCACTGCGGCCCAGCAAGGGGGCCAGGCCAACCACCCCACAGCAGCCGTGGTGACGGAGAAG
CAG
CAGATGCTGGAGCAGCACCTTCAGGATGTCCGGAAGAGAGTGCAGGATCTAGAACAGAAAATGAAAG
TG
GTAGAGAATCTCCAGGATGACTTTGATTTCAACTATAAAACCCTCAAGAGTCAAGGAGACATGCAAGA
T
CTGAATGGAAACAACCAGTCAGTGACCAGGCAGAAGATGCAGCAGCTGGAACAGATGCTCACTGCGCTG
GAC
CAGATGCGGAGAAGCATCGTGAGTGAGCTGGCGGGGCTTTTGTCAGCGATGGAGTACGTGCAGAAAA
CT
CTCACGGACGAGGAGCTGGCTGACTGGAAGAGGCGGCAACAGATTGCCTGCATTGGAGGCCCGCCCAA
C
ATCTGCCTAGATCGGCTAGAAAACTGGATAACGTCATTAGCAGAATCTCAACTTCAGACCCGTCAACAA
ATT
AAGAAACTGGAGGAGTTGCAGCAAAAAGTTTCCTACAAAGGGGACCCCATTGTACAGCACCGGCCGA
TG
CTGGAGGAGAGAATCGTGGAGCTGTTTAGAAACTTAATGAAAAGTGCCTTTGTGGTGGAGCGGCAGCC
C
TGCATGCCCATGCATCCTGACCGGCCCCTCGTCATCAAGACCGGCGTCCAGTTCACTACTAAAGTCAGG
TTG
CTGGTCAAATTCCCTGAGTTGAATTATCAGCTTAAAATTAAAGTGTGCATTGACAAAGACTCTGGGG
AC
GTTGCAGCTCTCAGAGGATCCCGGAAATTTAACATTCTGGGCACAAACACAAAAGTGATGAACATGGA
A
GAATCCAACAACGGCAGCCTCTCTGCAGAATTCAAACACTTGACCCTGAGGGAGCAGAGATGTGGGAAT
GGG
GGCCGAGCCAATTGTGATGCTTCCCTGATTGTGACTGAGGAGCTGCACCTGATCACCTTTGAGACCG
AG
GTGTATCACCAAGGCCTCAAGATTGACCTAGAGACCCACTCCTTGCCAGTTGTGGTGATCTCCAACAT
C
TGTCAGATGCCAAATGCCTGGGCGTCCATCCTGTGGTACAACATGCTGACCAACAATCCCAAGAATGTA
AAC
TTTTTTACCAAGCCCCCAATTGGAACCTGGGATCAAGTGGCCGAGGTCCTGAGCTGGCAGTTCTCCT
CC
ACCACCAAGCGAGGACTGAGCATCGAGCAGCTGACTACACTGGCAGAGAAACTCTTGGGACCTGGTGT
G
AATTATTCAGGGTGTCAGATCACATGGGCTAAATTTTGCAAAGAAAACATGGCTGGCAAGGGCTTCTCC
TTC
TGGGTCTGGCTGGACAATATCATTGACCTTGTGAAAAAGTACATCCTGGCCCTTTGGAACGAAGGGT
AC
ATCATGGGCTTTATCAGTAAGGAGCGGGAGCGGGCCATCTTGAGCACTAAGCCTCCAGGCACCTTCCT
G
CTAAGATTCAGTGAAAGCAGCAAAGAAGGAGGCGTCACTTTCACTTGGGTGGAGAAGGACATCAGCGGT
AAG
ACCCAGATCCAGTCCGTGGAACCATACACAAAGCAGCAGCTGAACAACATGTCATTTGCTGAAATCA
TC
ATGGGCTATAAGATCATGGATGCTACCAATATCCTGGTGTCTCCACTGGTCTATCTCTATCCTGACAT
T
CCCAAGGAGGAGGCATTCGGAAAGTATTGTCGGCCAGAGAGCCAGGAGCATCCTGAAGCTGACCCAGGT
A
GC
GCTGCCCCATACCTGAAGACCAAGTTTATCTGTGTGACACCAACGACCTGCAGCAATACCATTGACC
TG
CCGATGTCCCCCCGCACTTTAGATTCATTGATGCAGTTTGGAAATAATGGTGAAGGTGCTGAACCCTC
A
GCAGGAGGGCAGTTTGAGTCCCTCACCTTTGACATGGAGTTGACCTCGGAGTGCGCTACCTCCCCCATG
TGA


Translation (770 aa):
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR
F
LQESNVLYQHNLRRIKQFLQ
SRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK
Q
QMLEQHLQDVRKRVQ
DLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL
D
QMRR
SIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ
I
KKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMK
SAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR
L
LVKFPELNYQLKIKVCID
KDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
G
GRANCD
ASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV
N
FFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLL
GPGVNYSGCQITWAKFCKENMAGKGFS
F
WVWLDNIIDLVKKYILALWNE
GYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG
K
TQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG

S
AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser