NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32963.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32963.1 Public Homo sapiens 19 CRTC1 20 108 85 CCDS HistoryNCBI Gene:23373Re-query CCDS DB by CCDS ID:32963.1Re-query CCDS DB by GeneID:23373See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32963.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000321949 ENSP00000323332 Accepted alive Link to Ensembl Transcript Viewer:ENST00000321949Link to Ensembl Protein Viewer:ENSP00000323332Re-query CCDS DB by Nucleotide ID:ENST00000321949Re-query CCDS DB by Protein ID:ENSP00000323332
Original member Current member EBI,WTSI OTTHUMT00000465151 OTTHUMP00000270904 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000465151Link to Vega Protein Viewer:OTTHUMP00000270904Re-query CCDS DB by Nucleotide ID:OTTHUMT00000465151Re-query CCDS DB by Protein ID:OTTHUMP00000270904
Original member Current member NCBI NM_015321.2 NP_056136.2 Accepted alive Link to Nucleotide Sequence:NM_015321.2Link to Protein Sequence:NP_056136.2Re-query CCDS DB by Nucleotide ID:NM_015321Re-query CCDS DB by Protein ID:NP_056136Link to BLAST:NP_056136.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056136.2 634 Q6UUV9-1 634 100% 0 0

Chromosomal Locations for CCDS 32963.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 18683703 18683828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18742910 18743026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18745823 18745960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18747053 18747114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18749781 18749875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18753500 18753585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18759551 18759591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18760008 18760228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18765404 18765528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18768485 18768793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18771442 18771546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18774900 18774986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18775641 18775821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 18777171 18777382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1905 nt):
ATGGCGACTTCGAACAATCCGCGGAAATTCAGCGAGAAGATCGCGCTGCACAATCAGAAGCAGGCGGAGG
AG
ACGGCGGCCTTCGAGGAGGTCATGAAGGACCTGAGCCTGACGCGGGCCGCGCGGCTCCAGCTCCAGAA
A
TCCCAGTACCTGCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAG
ATC
GGGAGTGGCACCATGGACCTGCCCTTCCAGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGA
CC
ACCCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCG
G
CCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCA
CCC
GCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCACGC
AG
CCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGG
A
ATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGG
TCC
AGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAACACTACAG
CC
CTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCCCTCCCC
G
CTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAAC
CTC
GCGGCCAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTC
CA
CAGCACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCC
C
ACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTG
CCC
TACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCCTC
CA
CCCGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGTGGCCC
C
CTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGTCACGGTACCGTCCTCT
CTC
CCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATCGATGGGGATCGACATCGCCTCGGCGCCGGCTC
TG
CAGCAGTACCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGG
C
TTCTCCCCAGGGAGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAG
CAG
CAGATGGCGGCCAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACG
CC
ATCAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCT
C
ACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAAC
ATC
ATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGGGG
TC
GGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCT
C
GACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCGG
ATG
GACCGCCTGTGA


Translation (634 aa):
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ
I
GSGTMDLPFQ
TPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP
P
ADTSWR
RTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG
S
RPKSCEVPGI
NIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN
L
AANLTHLGIGGAGQ
GMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQL
P
YAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS
L
PQSPPENPGQPSMGIDIAS
APALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE
Q
QMAARQANALSHQ
LEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN
I
ILT
VTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR
M
DRL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser