NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3997.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3997.1 Public Homo sapiens 5 CCNB1 20 108 85 CCDS HistoryNCBI Gene:891Re-query CCDS DB by CCDS ID:3997.1Re-query CCDS DB by GeneID:891See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3997.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000256442 ENSP00000256442 Accepted alive Link to Ensembl Transcript Viewer:ENST00000256442Link to Ensembl Protein Viewer:ENSP00000256442Re-query CCDS DB by Nucleotide ID:ENST00000256442Re-query CCDS DB by Protein ID:ENSP00000256442
Original member Current member EBI,WTSI OTTHUMT00000215084 OTTHUMP00000123478 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000215084Link to Vega Protein Viewer:OTTHUMP00000123478Re-query CCDS DB by Nucleotide ID:OTTHUMT00000215084Re-query CCDS DB by Protein ID:OTTHUMP00000123478
Original member Current member NCBI NM_031966.3 NP_114172.1 Accepted alive Link to Nucleotide Sequence:NM_031966.3Link to Protein Sequence:NP_114172.1Re-query CCDS DB by Nucleotide ID:NM_031966Re-query CCDS DB by Protein ID:NP_114172Link to BLAST:NP_114172.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_114172.1 433 P14635-1 433 100% 0 0

Chromosomal Locations for CCDS 3997.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 69167263 69167283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69167908 69168078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69168173 69168343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69171270 69171452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69174251 69174409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69174877 69175113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69175397 69175537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69177239 69177349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 69177524 69177631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1302 nt):
ATGGCGCTCCGAGTCACCAGGAACTCGAAAATTAATGCTGAAAATAAGGCGAAGATCAACATGGCAGGCG
CA
AAGCGCGTTCCTACGGCCCCTGCTGCAACCTCCAAGCCCGGACTGAGGCCAAGAACAGCTCTTGGGGA
C
ATTGGTAACAAAGTCAGTGAACAACTGCAGGCCAAAATGCCTATGAAGAAGGAAGCAAAACCTTCAGCT
ACT
GGAAAAGTCATTGATAAAAAACTACCAAAACCTCTTGAAAAGGTACCTATGCTGGTGCCAGTGCCAG
TG
TCTGAGCCAGTGCCAGAGCCAGAACCTGAGCCAGAACCTGAGCCTGTTAAAGAAGAAAAACTTTCGCC
T
GAGCCTATTTTGGTTGATACTGCCTCTCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAA
GAC
CTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGTGGATGCAGAAGATGGAGCTGATC
CA
AACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTTGAGGAAGAGCAAGCAGT
C
AGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTA
CAG
GTTCAAATGAAATTCAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCA
TG
CAGAATAATTGTGTGCCCAAGAAGATGCTGCAGCTGGTTGGTGTCACTGCCATGTTTATTGCAAGCAA
A
TATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAACACTTATACTAAGCAC
CAA
ATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGGTCTGGGTCGGCCTCTACCTTTGC
AC
TTCCTTCGGAGAGCATCTAAGATTGGAGAGGTTGATGTCGAGCAACATACTTTGGCCAAATACCTGAT
G
GAACTAACTATGTTGGACTATGACATGGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGC
TTA
GCACTGAAAATTCTGGATAATGGTGAATGGACACCAACTCTACAACATTACCTGTCATATACTGAAG
AA
TCTCTTCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAAGCA
C
ATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTGAATTCT
GCA
CTAGTTCAAGATTTAGCCAAGGCTGTGGCAAAGGTGTAA


Translation (433 aa):
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSA
T
GKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPIL
VDTASPSPMETSGCAPAEE
D
LCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLE
EEQAVRPKYLLGREVTGNMRAILIDWLV
Q
VQMKFRLLQETMYMTVSIIDRFMQ
NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKH
Q
IRQMEMKILRALNFGLGRPLPLHFLRRASKIGE
VDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFC
L
ALKILDNGEW
TPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
A
LVQDLAKAVAKV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser