NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9597.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9597.1 Public Homo sapiens 14 IL25 20 108 85 CCDS HistoryNCBI Gene:64806Re-query CCDS DB by CCDS ID:9597.1Re-query CCDS DB by GeneID:64806See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9597.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000329715 ENSP00000328111 Accepted alive Link to Ensembl Transcript Viewer:ENST00000329715Link to Ensembl Protein Viewer:ENSP00000328111Re-query CCDS DB by Nucleotide ID:ENST00000329715Re-query CCDS DB by Protein ID:ENSP00000328111
Original member Current member EBI,WTSI OTTHUMT00000071789 OTTHUMP00000027946 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000071789Link to Vega Protein Viewer:OTTHUMP00000027946Re-query CCDS DB by Nucleotide ID:OTTHUMT00000071789Re-query CCDS DB by Protein ID:OTTHUMP00000027946
Original member Current member NCBI NM_022789.3 NP_073626.1 Accepted alive Link to Nucleotide Sequence:NM_022789.3Link to Protein Sequence:NP_073626.1Re-query CCDS DB by Nucleotide ID:NM_022789Re-query CCDS DB by Protein ID:NP_073626Link to BLAST:NP_073626.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_073626.1 177 Q9H293-1 177 100% 0 0

Chromosomal Locations for CCDS 9597.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 23373119 23373396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 23375625 23375880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (534 nt):
ATGAGGGAGCGACCCAGATTAGGTGAGGACAGTTCTCTCATTAGCCTTTTCCTACAGGTGGTTGCATTCT
TG
GCAATGGTCATGGGAACCCACACCTACAGCCACTGGCCCAGCTGCTGCCCCAGCAAAGGGCAGGACAC
C
TCTGAGGAGCTGCTGAGGTGGAGCACTGTGCCTGTGCCTCCCCTAGAGCCTGCTAGGCCCAACCGCCAC
CCA
GAGTCCTGTAGGGCCAGTGAAGATGGACCCCTCAACAGCAGGGCCATCTCCCCCTGGAGATATGAGT
TG
GACAGAGACTTGAACCGGCTCCCCCAGGACCTGTACCACGCCCGTTGCCTGTGCCCGCACTGCGTCAG
C
CTACAGACAGGCTCCCACATGGACCCCCGGGGCAACTCGGAGCTGCTCTACCACAACCAGACTGTCTTC
TAC
CGGCGGCCATGCCATGGCGAGAAGGGCACCCACAAGGGCTACTGCCTGGAGCGCAGGCTGTACCGTG
TT
TCCTTAGCTTGTGTGTGTGTGCGGCCCCGTGTGATGGGCTAG


Translation (177 aa):
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH
P
ESCRASEDGPLNSRAISPWRY
ELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVF
Y
RRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser