NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5465.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5465.1 Public Homo sapiens 7 GLI3 20 108 85 CCDS HistoryNCBI Gene:2737Re-query CCDS DB by CCDS ID:5465.1Re-query CCDS DB by GeneID:2737See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5465.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000395925 ENSP00000379258 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395925Link to Ensembl Protein Viewer:ENSP00000379258Re-query CCDS DB by Nucleotide ID:ENST00000395925Re-query CCDS DB by Protein ID:ENSP00000379258
Original member Current member EBI,WTSI OTTHUMT00000250806 OTTHUMP00000159085 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000250806Link to Vega Protein Viewer:OTTHUMP00000159085Re-query CCDS DB by Nucleotide ID:OTTHUMT00000250806Re-query CCDS DB by Protein ID:OTTHUMP00000159085
Original member Current member NCBI NM_000168.5 NP_000159.3 Accepted alive Link to Nucleotide Sequence:NM_000168.5Link to Protein Sequence:NP_000159.3Re-query CCDS DB by Nucleotide ID:NM_000168Re-query CCDS DB by Protein ID:NP_000159Link to BLink:NP_000159.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000159.3 1580 P10071 1580 100% 0 0

Chromosomal Locations for CCDS 5465.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 41964330 41966641 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 41967596 41967923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 41972337 41972627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 41977558 41977722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 41978599 41978748 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42023468 42023608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42025264 42025377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42026199 42026412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42040038 42040239 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42045384 42045530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42048491 42048696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42076752 42076857 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42148226 42148468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 42223130 42223253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4743 nt):
ATGGAGGCCCAGTCCCACAGCTCCACGACCACTGAAAAGAAAAAAGTTGAGAATTCCATAGTGAAGTGCT
CC
ACTCGAACAGATGTGAGCGAGAAAGCCGTTGCCTCCAGCACCACTTCTAATGAGGATGAAAGTCCTGG
A
CAGACTTATCACAGAGAGAGAAGAAACGCAATCACTATGCAGCCACAGAATGTCCAGGGGCTCAGCAAA
GTC
AGTGAGGAACCTTCAACATCGAGTGACGAGAGGGCCTCATTGATCAAGAAAGAGATCCATGGGTCCC
TG
CCACACGTGGCGGAGCCCTCTGTGCCGTACCGCGGGACGGTGTTTGCCATGGACCCCAGGAATGGTTA
C
ATGGAGCCCCACTACCACCCTCCTCATCTTTTCCCTGCCTTCCATCCTCCTGTACCAATTGATGCCAGA
CAT
CATGAGGGCCGTTACCATTACGATCCATCTCCGATTCCTCCATTGCATATGACTTCCGCCTTATCTA
GT
AGCCCTACGTATCCGGACCTGCCCTTCATTAGGATCTCCCCACACCGGAACCCCACTGCTGCTTCCGA
G
TCTCCCTTCAGCCCTCCACATCCCTACATTAATCCCTACATGGACTATATCCGCTCCTTGCACAGCAGC
CCA
TCGCTCTCCATGATCTCAGCAACCCGTGGGCTGAGCCCTACAGATGCGCCCCATGCAGGAGTCAGCC
CA
GCAGAATACTATCATCAGATGGCCCTGCTAACTGGCCAGCGCAGCCCCTATGCAGACATTATTCCCTC
A
GCTGCCACCGCCGGCACGGGGGCCATCCACATGGAATATCTTCATGCTATGGATAGCACCAGATTCTCC
AGC
CCCAGGCTGTCAGCCAGGCCGAGCCGAAAACGTACACTGTCCATATCACCACTCTCCGATCATAGCT
TT
GACCTTCAGACCATGATAAGGACGTCTCCCAACTCCTTGGTCACGATTCTCAATAATTCCCGTAGCAG
C
TCTTCAGCAAGTGGCTCCTATGGTCACTTATCTGCAAGTGCAATCAGCCCTGCCTTGAGCTTCACCTAC
TCT
TCCGCGCCCGTCTCTCTCCACATGCATCAGCAGATCCTAAGCCGACAACAGAGCTTAGGTTCAGCCT
TT
GGACACAGCCCTCCACTCATCCACCCTGCCCCAACTTTTCCAACACAGAGGCCTATTCCAGGGATCCC
T
ACGGTTCTGAACCCCGTCCAGGTCAGCTCCGGCCCTTCTGAGTCCTCACAGAACAAGCCCACGAGTGAG
TCT
GCAGTGAGCAGCACTGGTGACCCGATGCACAACAAGAGGTCCAAGATCAAACCCGATGAAGACCTCC
CC
AGCCCAGGGGCTCGGGGGCAGCAGGAACAGCCCGAAGGAACAACCCTTGTCAAGGAGGAAGGGGACAA
A
GATGAAAGCAAACAGGAGCCTGAAGTCATCTATGAGACAAACTGCCACTGGGAAGGCTGCGCGAGGGAG
TTC
GACACCCAAGAGCAGCTTGTGCACCATATAAATAACGACCATATTCATGGAGAGAAGAAGGAGTTCG
TG
TGCAGGTGGCTGGACTGCTCAAGAGAGCAGAAACCCTTCAAAGCCCAGTATATGTTGGTAGTGCATAT
G
AGAAGACACACGGGCGAGAAGCCTCACAAATGCACTTTTGAAGGTTGCACAAAGGCCTACTCGAGACTA
GAA
AACTTGAAAACACACTTGAGATCTCACACTGGAGAGAAACCATACGTCTGTGAGCACGAAGGTTGCA
AC
AAGGCTTTCTCAAATGCCTCTGATCGCGCCAAACACCAAAACAGAACGCATTCCAATGAGAAACCATA
T
GTGTGCAAAATCCCAGGCTGCACTAAGCGTTACACAGACCCAAGCTCCCTCCGGAAACATGTGAAGACA
GTG
CATGGCCCAGAGGCTCATGTCACCAAGAAGCAGCGAGGGGACATCCATCCTCGGCCGCCACCCCCGA
GA
GATTCCGGCAGCCATTCACAGTCCAGGTCGCCTGGCCGACCGACTCAGGGAGCCCTTGGTGAGCAGCA
G
GACCTCAGCAACACTACCTCAAAGCGGGAAGAATGCCTCCAGGTGAAAACCGTCAAGGCAGAGAAGCCA
ATG
ACATCTCAGCCAAGCCCTGGTGGTCAGTCTTCATGCAGCAGCCAACAGTCCCCCATCAGCAACTATT
CC
AACAGTGGGCTCGAGCTTCCTCTGACCGATGGAGGTAGTATAGGAGACCTCAGTGCCATCGATGAAAC
C
CCAATCATGGACTCAACCATTTCCACTGCAACCACAGCCCTTGCTTTGCAAGCCAGGAGAAACCCGGCA
GGG
ACCAAATGGATGGAGCACGTAAAACTAGAAAGGCTAAAACAAGTGAATGGAATGTTTCCGCGACTGA
AC
CCCATTCTACCCCCTAAAGCCCCTGCGGTCTCTCCTCTCATAGGAAATGGCACACAGTCCAACAACAC
C
TGCAGCTTGGGTGGGCCCATGACGCTTCTCCCGGGCAGAAGCGACCTCTCTGGGGTGGACGTCACTATG
CTG
AACATGCTCAACAGAAGGGACAGCAGCGCCAGCACCATCAGCTCGGCCTACCTGAGCAGCCGCCGCT
CC
TCAGGGATCTCGCCCTGCTTCTCCAGCCGCCGCTCCAGCGAGGCGTCACAGGCCGAGGGCCGGCCGCA
G
AACGTGAGCGTGGCCGACTCCTACGACCCCATCTCCACCGACGCCTCGCGCCGCTCCAGCGAAGCCAGC
CAG
AGCGACGGCCTGCCCAGCCTGCTCAGCCTCACGCCCGCCCAGCAGTACCGCCTCAAGGCCAAGTACG
CG
GCTGCCACAGGAGGGCCGCCGCCGACGCCCCTGCCCAACATGGAGAGGATGAGCCTGAAGACGCGCCT
G
GCGCTGCTCGGGGATGCCCTCGAGCCTGGCGTGGCCCTGCCTCCAGTTCATGCCCCGAGGAGGTGCAGC
GAC
GGGGGAGCCCACGGCTACGGGCGGCGCCACCTGCAGCCGCACGATGCGCCGGGCCACGGCGTGAGGA
GG
GCCAGCGACCCGGTGCGGACAGGCTCCGAGGGCCTGGCCCTGCCTCGTGTGCCGCGCTTCAGCAGCCT
C
AGCAGCTGCAACCCCCCGGCGATGGCCACGTCCGCGGAGAAGCGCAGTCTCGTGCTTCAGAATTACACG
CGG
CCCGAGGGCGGCCAGTCCCGAAACTTCCACTCGTCCCCCTGTCCTCCCAGCATCACCGAGAACGTCA
CC
CTGGAGTCCCTGACCATGGACGCTGATGCCAACCTGAACGATGAGGATTTCCTGCCGGACGACGTGGT
G
CAGTATTTAAATTCCCAGAACCAAGCAGGGTACGAGCAGCACTTCCCCAGCGCCCTCCCGGACGACAGC
AAA
GTGCCCCACGGGCCCGGTGACTTTGACGCGCCCGGGCTGCCAGACAGCCACGCTGGCCAGCAGTTCC
AT
GCCCTCGAGCAGCCCTGCCCCGAGGGCAGCAAAACCGACCTGCCCATTCAGTGGAACGAAGTCAGCTC
C
GGAAGCGCCGACCTGTCCTCCTCCAAGCTCAAGTGTGGGCCGCGGCCCGCTGTGCCGCAGACTCGCGCC
TTT
GGGTTCTGCAACGGCATGGTCGTCCACCCGCAGAACCCCTTGAGGAGCGGGCCTGCTGGGGGCTATC
AG
ACCCTCGGGGAGAACAGCAACCCCTACGGTGGCCCAGAGCACTTGATGCTCCACAACAGCCCCGGAAG
T
GGCACCAGTGGAAACGCCTTCCATGAACAGCCCTGTAAGGCCCCGCAGTATGGGAACTGTCTCAACAGG
CAG
CCAGTGGCCCCTGGTGCACTCGACGGTGCCTGTGGTGCCGGGATTCAAGCCTCAAAGCTGAAGAGCA
CC
CCCATGCAAGGGAGCGGGGGCCAGCTGAATTTCGGCCTGCCGGTAGCGCCAAATGAGTCAGCTGGCAG
C
ATGGTGAATGGCATGCAGAACCAGGACCCAGTGGGACAGGGGTACCTGGCTCACCAGCTCCTCGGCGAC
AGC
ATGCAGCACCCGGGGGCAGGCCGCCCCGGTCAGCAGATGCTTGGGCAGATTAGTGCTACCTCACACA
TC
AACATCTACCAAGGGCCAGAGAGCTGCCTGCCAGGGGCTCACGGCATGGGCAGCCAGCCGTCAAGCTT
G
GCAGTTGTCAGGGGCTACCAGCCATGTGCCAGCTTTGGGGGCAGCAGGCGCCAGGCTATGCCGAGGGAC
AGC
CTTGCTCTGCAGTCAGGACAGCTCAGTGACACAAGTCAGACCTGCAGGGTGAATGGTATCAAGATGG
AG
ATGAAAGGGCAGCCCCATCCGCTGTGCTCTAATCTGCAGAATTACTCTGGTCAGTTCTATGACCAAAC
C
GTGGGCTTCAGTCAGCAAGACACGAAAGCTGGTTCATTCTCTATTTCAGACGCCAGCTGCCTGCTACAG
GGG
ACCAGCGCCAAAAACTCTGAGTTACTTTCCCCAGGTGCTAATCAGGTGACAAGCACAGTGGACAGCC
TC
GACAGCCATGACCTGGAAGGGGTACAGATTGACTTCGATGCCATCATAGACGATGGGGACCACTCCAG
C
CTGATGTCGGGGGCCCTGAGCCCAAGTATCATTCAGAACCTTTCCCATAGCTCCTCCCGCCTCACCACG
CCT
CGGGCGTCCCTCCCATTCCCAGCGCTGTCCATGAGCACCACCAACATGGCTATCGGGGACATGAGTT
CT
TTGCTGACCTCCCTAGCGGAAGAAAGCAAATTCCTTGCAGTTATGCAATAG


Translation (1580 aa):
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSK
V
SEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHY
HPPHLFPAFHPPVPIDAR
H
HEGRYHYDPSPIPPLH
MTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSS
P
SLSMISATRGLSPTD
APHAGVSPAEYYHQMALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFS
S
PRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAI
SPALSFTY
S
SAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQ
NKPTSE
S
AVSSTGDPMHNKRSKIKPDEDLPSPGARGQQ
EQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCARE
F
DTQEQLVH
HINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRL
E
NLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNE
KPYVCKIPGCTKRYTDPSSLRKHVKT
V
HGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKP
M
TSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPA
G
TKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGN
GTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
L
NMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEAS
Q
SDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALLGDALEPGVALPPVHAPRRCS
D
GGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYT
R
PEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDS
K
VPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRA
F
GFCNGMVVHPQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
Q
PVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGD
S
MQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRD
S
LALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQ
G
TSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTT
P
RASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser