NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19271.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19271.1 Public Mus musculus 5 Ldb2 21 106 86 CCDS HistoryNCBI Gene:16826Re-query CCDS DB by CCDS ID:19271.1Re-query CCDS DB by GeneID:16826See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19271.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070748 ENSMUSP00000067737 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070748Link to Ensembl Protein Viewer:ENSMUSP00000067737Re-query CCDS DB by Nucleotide ID:ENSMUST00000070748Re-query CCDS DB by Protein ID:ENSMUSP00000067737
Original member Current member EBI,WTSI OTTMUST00000133955 OTTMUSP00000071122 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000133955Link to Vega Protein Viewer:OTTMUSP00000071122Re-query CCDS DB by Nucleotide ID:OTTMUST00000133955Re-query CCDS DB by Protein ID:OTTMUSP00000071122
Original member Current member NCBI NM_010698.4 NP_034828.3 Accepted alive Link to Nucleotide Sequence:NM_010698.4Link to Protein Sequence:NP_034828.3Re-query CCDS DB by Nucleotide ID:NM_010698Re-query CCDS DB by Protein ID:NP_034828Link to BLink:NP_034828.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034828.3 373 O55203-1 373 100% 0 0

Chromosomal Locations for CCDS 19271.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 44473282 44473512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44479093 44479244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44480226 44480349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44532661 44532744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44535038 44535160 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44541687 44541859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44669357 44669459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 44799362 44799493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1122 nt):
ATGTCCAGCACACCACATGACCCCTTCTATTCTTCTCCTTTCGGCCCATTTTATAGGAGACATACACCAT
AC
ATGGTACAGCCAGAGTACCGAATCTATGAGATGAACAAGAGACTGCAGTCTCGTACAGAGGACAGTGA
C
AACCTCTGGTGGGATGCGTTTGCCACTGAATTTTTTGAAGATGATGCCACATTAACACTTTCATTTTGT
TTG
GAAGACGGACCAAAGCGATACACTATCGGCAGGACCCTCATTCCCCGTTATTTTAGCACCGTATTTG
AA
GGAGGGGTGACAGACCTGTACTACATCCTTAAACACTCAAAGGAGTCATATCACAACTCATCCATCAC
A
GTAGACTGCGACCAGTGTGCCATGGTCACACAGCATGGGAAGCCCATGTTTACCAAGGTATGCACAGAA
GGC
AGGCTGATCTTGGAATTCACATTTGATGACCTCATGAGAATAAAAACGTGGCACTTTACCATTAGAC
AG
TACAGGGAGCTGGTCCCCAGAAGCATACTAGCCATGCACGCACAAGATCCTCAGGTCCTGGATCAGCT
G
TCCAAAAATATCACCAGGATGGGTCTCACAAACTTCACCCTCAACTACCTCAGGTTGTGTGTAATACTG
GAG
CCAATGCAGGAACTGATGTCGAGACACAAAACCTACAACCTCAGTCCCCGAGACTGCCTGAAGACCT
GT
CTGTTTCAGAAGTGGCAGCGGATGGTGGCCCCGCCAGCAGAACCCACAAGGCAACCGACAACCAAAAG
G
AGAAAACGAAAAAACTCCACAAGCAGCACGTCCAATAGCAGTGCCGGGAACACGACCAACAGTGCCGGC
AGC
AAGAAGAAGACCCCGGCGGCAAGCCTGAGCCTGGCCACTCAGGTACCTGATGTGATGGTGGTAGGAG
AG
CCAACTCTGATGGGAGGTGAGTTTGGGGACGAGGACGAAAGGCTAATCACTAGATTAGAAAACACGCA
G
TATGATGCGGCCAACGGCATGGACGACGAAGAAGACTTCAACAATTCACCTGCCCTGGGGAACAACAGC
CCG
TGGAACAGTAAACCTCCCGCCACGCAAGAGACCAAATCAGAAAACGCCCCACCCCAGGCTTCCCAGT
AA


Translation (373 aa):
MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFC
L
EDGPKRY
TIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTE
G
RLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMH
AQDPQVLDQLSKNITRMGLTNFTLNYLRLCVIL
E
PMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP
AEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAG
S
KKKTPAASLSLATQVP
DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNS
P
WNSKPPATQETKSENAPPQASQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser