NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11561.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11561.1 Public Homo sapiens 17 COL1A1 20 108 85 CCDS HistoryNCBI Gene:1277Re-query CCDS DB by CCDS ID:11561.1Re-query CCDS DB by GeneID:1277See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11561.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000225964 ENSP00000225964 Accepted alive Link to Ensembl Transcript Viewer:ENST00000225964Link to Ensembl Protein Viewer:ENSP00000225964Re-query CCDS DB by Nucleotide ID:ENST00000225964Re-query CCDS DB by Protein ID:ENSP00000225964
Original member Current member EBI,WTSI OTTHUMT00000309036 OTTHUMP00000192905 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000309036Link to Vega Protein Viewer:OTTHUMP00000192905Re-query CCDS DB by Nucleotide ID:OTTHUMT00000309036Re-query CCDS DB by Protein ID:OTTHUMP00000192905
Original member Current member NCBI NM_000088.3 NP_000079.2 Accepted alive Link to Nucleotide Sequence:NM_000088.3Link to Protein Sequence:NP_000079.2Re-query CCDS DB by Nucleotide ID:NM_000088Re-query CCDS DB by Protein ID:NP_000079Link to BLink:NP_000079.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000079.2 1464 P02452 1464 99.9317% 0 1

Chromosomal Locations for CCDS 11561.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 50185502 50185648 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50185778 50186020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50186317 50186507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50186640 50186922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50187015 50187122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50187484 50187537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50187876 50187983 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50188096 50188149 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50188530 50188637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50188742 50188795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50188903 50189010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50189168 50189275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50189377 50189538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50189679 50189732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50189859 50189912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50190001 50190108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50190327 50190380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50190543 50190596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50190817 50190924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50191383 50191490 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50191788 50191886 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50191980 50192024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50192475 50192528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50192640 50192693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50192797 50192850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50192994 50193047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50193943 50194041 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50194130 50194183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50194349 50194447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50194573 50194626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50194721 50194828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50195047 50195100 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50195232 50195330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50195434 50195478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50195567 50195665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50195923 50195976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50196155 50196199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50196314 50196367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50196484 50196528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50196617 50196670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50197010 50197063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50197180 50197233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50197732 50197785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50197949 50198002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50198161 50198205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50198433 50198504 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50199226 50199327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50199418 50199453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50199556 50199590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50199753 50199947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 50201411 50201513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4395 nt):
ATGTTCAGCTTTGTGGACCTCCGGCTCCTGCTCCTCTTAGCGGCCACCGCCCTCCTGACGCACGGCCAAG
AG
GAAGGCCAAGTCGAGGGCCAAGACGAAGACATCCCACCAATCACCTGCGTACAGAACGGCCTCAGGTA
C
CATGACCGAGACGTGTGGAAACCCGAGCCCTGCCGGATCTGCGTCTGCGACAACGGCAAGGTGTTGTGC
GAT
GACGTGATCTGTGACGAGACCAAGAACTGCCCCGGCGCCGAAGTCCCCGAGGGCGAGTGCTGTCCCG
TC
TGCCCCGACGGCTCAGAGTCACCCACCGACCAAGAAACCACCGGCGTCGAGGGACCCAAGGGAGACAC
T
GGCCCCCGAGGCCCAAGGGGACCCGCAGGCCCCCCTGGCCGAGATGGCATCCCTGGACAGCCTGGACTT
CCC
GGACCCCCCGGACCCCCCGGACCTCCCGGACCCCCTGGCCTCGGAGGAAACTTTGCTCCCCAGCTGT
CT
TATGGCTATGATGAGAAATCAACCGGAGGAATTTCCGTGCCTGGCCCCATGGGTCCCTCTGGTCCTCG
T
GGTCTCCCTGGCCCCCCTGGTGCACCTGGTCCCCAAGGCTTCCAAGGTCCCCCTGGTGAGCCTGGCGAG
CCT
GGAGCTTCAGGTCCCATGGGTCCCCGAGGTCCCCCAGGTCCCCCTGGAAAGAATGGAGATGATGGGG
AA
GCTGGAAAACCTGGTCGTCCTGGTGAGCGTGGGCCTCCTGGGCCTCAGGGTGCTCGAGGATTGCCCGG
A
ACAGCTGGCCTCCCTGGAATGAAGGGACACAGAGGTTTCAGTGGTTTGGATGGTGCCAAGGGAGATGCT
GGT
CCTGCTGGTCCTAAGGGTGAGCCTGGCAGCCCTGGTGAAAATGGAGCTCCTGGTCAGATGGGCCCCC
GT
GGCCTGCCTGGTGAGAGAGGTCGCCCTGGAGCCCCTGGCCCTGCTGGTGCTCGTGGAAATGATGGTGC
T
ACTGGTGCTGCCGGGCCCCCTGGTCCCACCGGCCCCGCTGGTCCTCCTGGCTTCCCTGGTGCTGTTGGT
GCT
AAGGGTGAAGCTGGTCCCCAAGGGCCCCGAGGCTCTGAAGGTCCCCAGGGTGTGCGTGGTGAGCCTG
GC
CCCCCTGGCCCTGCTGGTGCTGCTGGCCCTGCTGGAAACCCTGGTGCTGATGGACAGCCTGGTGCTAA
A
GGTGCCAATGGTGCTCCTGGTATTGCTGGTGCTCCTGGCTTCCCTGGTGCCCGAGGCCCCTCTGGACCC
CAG
GGCCCCGGCGGCCCTCCTGGTCCCAAGGGTAACAGCGGTGAACCTGGTGCTCCTGGCAGCAAAGGAG
AC
ACTGGTGCTAAGGGAGAGCCTGGCCCTGTTGGTGTTCAAGGACCCCCTGGCCCTGCTGGAGAGGAAGG
A
AAGCGAGGAGCTCGAGGTGAACCCGGACCCACTGGCCTGCCCGGACCCCCTGGCGAGCGTGGTGGACCT
GGT
AGCCGTGGTTTCCCTGGCGCAGATGGTGTTGCTGGTCCCAAGGGTCCCGCTGGTGAACGTGGTTCTC
CT
GGCCCTGCTGGCCCCAAAGGATCTCCTGGTGAAGCTGGTCGTCCCGGTGAAGCTGGTCTGCCTGGTGC
C
AAGGGTCTGACTGGAAGCCCTGGCAGCCCTGGTCCTGATGGCAAAACTGGCCCCCCTGGTCCCGCCGGT
CAA
GATGGTCGCCCCGGACCCCCAGGCCCACCTGGTGCCCGTGGTCAGGCTGGTGTGATGGGATTCCCTG
GA
CCTAAAGGTGCTGCTGGAGAGCCCGGCAAGGCTGGAGAGCGAGGTGTTCCCGGACCCCCTGGCGCTGT
C
GGTCCTGCTGGCAAAGATGGAGAGGCTGGAGCTCAGGGACCCCCTGGCCCTGCTGGTCCCGCTGGCGAG
AGA
GGTGAACAAGGCCCTGCTGGCTCCCCCGGATTCCAGGGTCTCCCTGGTCCTGCTGGTCCTCCAGGTG
AA
GCAGGCAAACCTGGTGAACAGGGTGTTCCTGGAGACCTTGGCGCCCCTGGCCCCTCTGGAGCAAGAGG
C
GAGAGAGGTTTCCCTGGCGAGCGTGGTGTGCAAGGTCCCCCTGGTCCTGCTGGTCCCCGAGGGGCCAAC
GGT
GCTCCCGGCAACGATGGTGCTAAGGGTGATGCTGGTGCCCCTGGAGCTCCCGGTAGCCAGGGCGCCC
CT
GGCCTTCAGGGAATGCCTGGTGAACGTGGTGCAGCTGGTCTTCCAGGGCCTAAGGGTGACAGAGGTGA
T
GCTGGTCCCAAAGGTGCTGATGGCTCTCCTGGCAAAGATGGCGTCCGTGGTCTGACTGGCCCCATTGGT
CCT
CCTGGCCCTGCTGGTGCCCCTGGTGACAAGGGTGAAAGTGGTCCCAGCGGCCCTGCTGGTCCCACTG
GA
GCTCGTGGTGCCCCCGGAGACCGTGGTGAGCCTGGTCCCCCCGGCCCTGCTGGCTTTGCTGGCCCCCC
T
GGTGCTGACGGCCAACCTGGTGCTAAAGGCGAACCTGGTGATGCTGGTGCTAAAGGCGATGCTGGTCCC
CCT
GGCCCTGCCGGACCCGCTGGACCCCCTGGCCCCATTGGTAATGTTGGTGCTCCTGGAGCCAAAGGTG
CT
CGCGGCAGCGCTGGTCCCCCTGGTGCTACTGGTTTCCCTGGTGCTGCTGGCCGAGTCGGTCCTCCTGG
C
CCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTGGTCCTGCTGGCAAAGAAGGCGGCAAAGGTCCCCGT
GGT
GAGACTGGCCCTGCTGGACGTCCTGGTGAAGTTGGTCCCCCTGGTCCCCCTGGCCCTGCTGGCGAGA
AA
GGATCCCCTGGTGCTGATGGTCCTGCTGGTGCTCCTGGTACTCCCGGGCCTCAAGGTATTGCTGGACA
G
CGTGGTGTGGTCGGCCTGCCTGGTCAGAGAGGAGAGAGAGGCTTCCCTGGTCTTCCTGGCCCCTCTGGT
GAA
CCTGGCAAACAAGGTCCCTCTGGAGCAAGTGGTGAACGTGGTCCCCCTGGTCCCATGGGCCCCCCTG
GA
TTGGCTGGACCCCCTGGTGAATCTGGACGTGAGGGGGCTCCTGGTGCCGAAGGTTCCCCTGGACGAGA
C
GGTTCTCCTGGCGCCAAGGGTGACCGTGGTGAGACCGGCCCCGCTGGACCCCCTGGTGCTCCTGGTGCT
CCT
GGTGCCCCTGGCCCCGTTGGCCCTGCTGGCAAGAGTGGTGATCGTGGTGAGACTGGTCCTGCTGGTC
CC
GCCGGTCCTGTCGGCCCTGTTGGCGCCCGTGGCCCCGCCGGACCCCAAGGCCCCCGTGGTGACAAGGG
T
GAGACAGGCGAACAGGGCGACAGAGGCATAAAGGGTCACCGTGGCTTCTCTGGCCTCCAGGGTCCCCCT
GGC
CCTCCTGGCTCTCCTGGTGAACAAGGTCCCTCTGGAGCCTCTGGTCCTGCTGGTCCCCGAGGTCCCC
CT
GGCTCTGCTGGTGCTCCTGGCAAAGATGGACTCAACGGTCTCCCTGGCCCCATTGGGCCCCCTGGTCC
T
CGCGGTCGCACTGGTGATGCTGGTCCTGTTGGTCCCCCCGGCCCTCCTGGACCTCCTGGTCCCCCTGGT
CCT
CCCAGCGCTGGTTTCGACTTCAGCTTCCTGCCCCAGCCACCTCAAGAGAAGGCTCACGATGGTGGCC
GC
TACTACCGGGCTGATGATGCCAATGTGGTTCGTGACCGTGACCTCGAGGTGGACACCACCCTCAAGAG
C
CTGAGCCAGCAGATCGAGAACATCCGGAGCCCAGAGGGCAGCCGCAAGAACCCCGCCCGCACCTGCCGT
GAC
CTCAAGATGTGCCACTCTGACTGGAAGAGTGGAGAGTACTGGATTGACCCCAACCAAGGCTGCAACC
TG
GATGCCATCAAAGTCTTCTGCAACATGGAGACTGGTGAGACCTGCGTGTACCCCACTCAGCCCAGTGT
G
GCCCAGAAGAACTGGTACATCAGCAAGAACCCCAAGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATG
ACC
GATGGATTCCAGTTCGAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGGCCATCCAGCTGACCT
TC
CTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATCACCTACCACTGCAAGAACAGCGTGGCCTACAT
G
GACCAGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCCAGGGCTCCAACGAGATCGAGATCCGCGCC
GAG
GGCAACAGCCGCTTCACCTACAGCGTCACTGTCGATGGCTGCACGAGTCACACCGGAGCCTGGGGCA
AG
ACAGTGATTGAATACAAAACCACCAAGACCTCCCGCCTGCCCATCATCGATGTGGCCCCCTTGGACGT
T
GGTGCCCCAGACCAGGAATTCGGCTTCGACGTTGGCCCTGTCTGCTTCCTGTAA


Translation (1464 aa):
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLC
D
DVICDETKNCPGAEVPEGECCPVCPDGS
ESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGL
P
GPPGPPGPPGPPGLGG
NFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGE
P
GAS
GPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDA
G
PAGPK
GEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVG
A
K
GEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP
Q
GPGGPPGPKGNS
GEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGP
G
SRGFPGADGVAGPK
GPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAG
Q
DGRPGPPGPPGARGQAGVMGFPGPKGAA
GEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGE
R
GEQGPAGSPGFQ
GLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGAN
G
APGNDGAK
GDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIG
P
PGPAGAPGDK
GESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP
P
GPAGPAGPPGPI
GNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPR
G
ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPA
GAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSG
E
PGKQGPSGASGERGPPGPMGPPGLAGPPGESGRE
GAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGA
P
GAPGPVGPAGKSGDRGET
GPAGPAGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPP
G
PP
GSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPG
P
PSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR
D
LKMCHSDWKS
GEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESM
T
DGFQ
FEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRA
E
GNSRFTYSVTVDGCT
SHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser