NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19268.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19268.1 Public Mus musculus 5 Fgfbp1 19 105 81 CCDS HistoryNCBI Gene:14181Re-query CCDS DB by CCDS ID:19268.1Re-query CCDS DB by GeneID:14181See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19268.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000061299 ENSMUSP00000056900 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000061299Link to Ensembl Protein Viewer:ENSMUSP00000056900Re-query CCDS DB by Nucleotide ID:ENSMUST00000061299Re-query CCDS DB by Protein ID:ENSMUSP00000056900
Original member Current member EBI,WTSI ENSMUST00000199894 ENSMUSP00000142520 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000199894Link to Ensembl Protein Viewer:ENSMUSP00000142520Re-query CCDS DB by Nucleotide ID:ENSMUST00000199894Re-query CCDS DB by Protein ID:ENSMUSP00000142520
Original member Current member EBI,WTSI ENSMUST00000199481 ENSMUSP00000143011 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000199481Link to Ensembl Protein Viewer:ENSMUSP00000143011Re-query CCDS DB by Nucleotide ID:ENSMUST00000199481Re-query CCDS DB by Protein ID:ENSMUSP00000143011
Original member Current member EBI,WTSI OTTMUST00000133820 OTTMUSP00000071066 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000133820Link to Vega Protein Viewer:OTTMUSP00000071066Re-query CCDS DB by Nucleotide ID:OTTMUST00000133820Re-query CCDS DB by Protein ID:OTTMUSP00000071066
Original member Current member EBI,WTSI OTTMUST00000133821 OTTMUSP00000071067 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000133821Link to Vega Protein Viewer:OTTMUSP00000071067Re-query CCDS DB by Nucleotide ID:OTTMUST00000133821Re-query CCDS DB by Protein ID:OTTMUSP00000071067
Original member Current member EBI,WTSI OTTMUST00000133822 OTTMUSP00000071068 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000133822Link to Vega Protein Viewer:OTTMUSP00000071068Re-query CCDS DB by Nucleotide ID:OTTMUST00000133822Re-query CCDS DB by Protein ID:OTTMUSP00000071068
Original member Current member NCBI NM_001271616.1 NP_001258545.1 Accepted alive Link to Nucleotide Sequence:NM_001271616.1Link to Protein Sequence:NP_001258545.1Re-query CCDS DB by Nucleotide ID:NM_001271616Re-query CCDS DB by Protein ID:NP_001258545Link to BLink:NP_001258545.1
Original member Current member NCBI NM_008009.4 NP_032035.2 Accepted alive Link to Nucleotide Sequence:NM_008009.4Link to Protein Sequence:NP_032035.2Re-query CCDS DB by Nucleotide ID:NM_008009Re-query CCDS DB by Protein ID:NP_032035Link to BLink:NP_032035.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258545.1 251 O70514 251 100% 0 0
NP_032035.2 251 O70514 251 100% 0 0

Chromosomal Locations for CCDS 19268.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 43979193 43979948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (756 nt):
ATGAGACTCCACAGCCTCATCCTGCTCTCCTTCCTTCTCCTGGCTACTCAGGCGTTCTCAGAAAAGGTCA
GA
AAGAGAGCCAAGAACGCACCACACAGCACAGCGGAGGAGGGGGTAGAGGGTTCAGCTCCCTCGTTAGG
G
AAGGCCCAGAATAAGCAGAGAAGCAGGACATCTAAATCTCTGACGCATGGCAAGTTTGTCACCAAAGAC
CAA
GCCACATGCAGATGGGCTGTGACTGAGGAGGAGCAGGGCATCAGCCTGAAGGTCCAGTGCACACAAG
CC
GATCAGGAGTTTTCTTGTGTTTTTGCTGGTGACCCAACTGACTGCCTTAAACACGACAAAGACCAGAT
C
TACTGGAAACAGGTTGCCCGCACGCTGCGCAAACAGAAAAATATCTGCAGGAACGCCAAGAGTGTCTTG
AAG
ACCAGAGTGTGCAGAAAGAGATTTCCAGAGTCTAACCTCAAGCTGGTGAACCCCAACGCACGTGGAA
AC
ACGAAGCCCAGGAAGGAGAAAGCAGAGGTCTCCGCAAGGGAGCACAACAAGGTCCAAGAAGCTGTCTC
C
ACGGAGCCAAACAGGGTCAAAGAAGACATCACACTCAATCCAGCTGCGACCCAGACCATGGCCATTAGA
GAT
CCAGAGTGTCTAGAGGATCCAGATGTGCTCAACCAGAGGAAGACCGCCCTGGAGTTCTGTGGGGAAT
CT
TGGAGCTCCATTTGCACATTCTTCCTCAACATGTTACAGGCGACATCATGCTAA


Translation (251 aa):
MRLHSLILLSFLLLATQAFSEKVRKRAKNAPHSTAEEGVEGSAPSLGKAQNKQRSRTSKSLTHGKFVTKD
Q
ATCRWAVTEEEQGISLKVQCTQADQEFSCVFAGDPTDCLKHDKDQIYWKQVARTLRKQKNICRNAKSVL
K
TRVCRKRFPESNLKLVNPNARGNTKPRKEKAEVSAREHNKVQEAVSTEPNRVKEDITLNPAATQTMAIR
D
PECLEDPDVLNQRKTALEFCGESWSSICTFFLNMLQATSC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser