NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14098.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14098.1 Public Homo sapiens 22 CPT1B 20 108 85 CCDS HistoryNCBI Gene:1375Re-query CCDS DB by CCDS ID:14098.1Re-query CCDS DB by GeneID:1375See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14098.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000312108 ENSP00000312189 Accepted alive Link to Ensembl Transcript Viewer:ENST00000312108Link to Ensembl Protein Viewer:ENSP00000312189Re-query CCDS DB by Nucleotide ID:ENST00000312108Re-query CCDS DB by Protein ID:ENSP00000312189
Original member Current member EBI,WTSI ENST00000360719 ENSP00000353945 Accepted alive Link to Ensembl Transcript Viewer:ENST00000360719Link to Ensembl Protein Viewer:ENSP00000353945Re-query CCDS DB by Nucleotide ID:ENST00000360719Re-query CCDS DB by Protein ID:ENSP00000353945
Original member Current member EBI,WTSI ENST00000395650 ENSP00000379011 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395650Link to Ensembl Protein Viewer:ENSP00000379011Re-query CCDS DB by Nucleotide ID:ENST00000395650Re-query CCDS DB by Protein ID:ENSP00000379011
Original member Current member EBI,WTSI ENST00000405237 ENSP00000385486 Accepted alive Link to Ensembl Transcript Viewer:ENST00000405237Link to Ensembl Protein Viewer:ENSP00000385486Re-query CCDS DB by Nucleotide ID:ENST00000405237Re-query CCDS DB by Protein ID:ENSP00000385486
Original member Current member EBI,WTSI OTTHUMT00000317264 OTTHUMP00000196838 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317264Link to Vega Protein Viewer:OTTHUMP00000196838Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317264Re-query CCDS DB by Protein ID:OTTHUMP00000196838
Original member Current member EBI,WTSI OTTHUMT00000317420 OTTHUMP00000196978 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317420Link to Vega Protein Viewer:OTTHUMP00000196978Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317420Re-query CCDS DB by Protein ID:OTTHUMP00000196978
Original member Current member EBI,WTSI OTTHUMT00000317421 OTTHUMP00000196979 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317421Link to Vega Protein Viewer:OTTHUMP00000196979Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317421Re-query CCDS DB by Protein ID:OTTHUMP00000196979
Original member Current member NCBI NM_001145135.1 NP_001138607.1 Accepted alive Link to Nucleotide Sequence:NM_001145135.1Link to Protein Sequence:NP_001138607.1Re-query CCDS DB by Nucleotide ID:NM_001145135Re-query CCDS DB by Protein ID:NP_001138607Link to BLink:NP_001138607.1
Original member Current member NCBI NM_001145137.1 NP_001138609.1 Accepted alive Link to Nucleotide Sequence:NM_001145137.1Link to Protein Sequence:NP_001138609.1Re-query CCDS DB by Nucleotide ID:NM_001145137Re-query CCDS DB by Protein ID:NP_001138609Link to BLink:NP_001138609.1
Original member Current member NCBI NM_004377.3 NP_004368.1 Accepted alive Link to Nucleotide Sequence:NM_004377.3Link to Protein Sequence:NP_004368.1Re-query CCDS DB by Nucleotide ID:NM_004377Re-query CCDS DB by Protein ID:NP_004368Link to BLink:NP_004368.1
Original member Current member NCBI NM_152245.2 NP_689451.1 Accepted alive Link to Nucleotide Sequence:NM_152245.2Link to Protein Sequence:NP_689451.1Re-query CCDS DB by Nucleotide ID:NM_152245Re-query CCDS DB by Protein ID:NP_689451Link to BLink:NP_689451.1
Original member Current member NCBI NM_152246.2 NP_689452.1 Accepted alive Link to Nucleotide Sequence:NM_152246.2Link to Protein Sequence:NP_689452.1Re-query CCDS DB by Nucleotide ID:NM_152246Re-query CCDS DB by Protein ID:NP_689452Link to BLink:NP_689452.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138607.1 772 Q92523-1 772 100% 0 0
NP_001138609.1 772 Q92523-1 772 100% 0 0
NP_004368.1 772 Q92523-1 772 100% 0 0
NP_689451.1 772 Q92523-1 772 100% 0 0
NP_689452.1 772 Q92523-1 772 100% 0 0

Chromosomal Locations for CCDS 14098.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 22Link to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 50569338 50569421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50569576 50569668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50570293 50570406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50570891 50571043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50571158 50571292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50571375 50571539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50572006 50572122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50572203 50572308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50572875 50573060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50573520 50573715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50574335 50574419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50574493 50574600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50576035 50576112 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50576198 50576335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50576536 50576637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50576857 50577034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50577324 50577463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50577775 50577915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2319 nt):
ATGGCGGAAGCTCACCAGGCCGTGGCCTTCCAGTTCACGGTGACCCCAGACGGGGTCGACTTCCGGCTCA
GT
CGGGAGGCCCTGAAACACGTCTACCTGTCTGGGATCAACTCCTGGAAGAAACGCCTGATCCGCATCAA
G
AATGGCATCCTCAGGGGCGTGTACCCTGGCAGCCCCACCAGCTGGCTGGTCGTCATCATGGCAACAGTG
GGT
TCCTCCTTCTGCAACGTGGACATCTCCTTGGGGCTGGTCAGTTGCATCCAGAGATGCCTCCCTCAGG
G
G
TGTGGCCCCTACCAGACCCCGCAGACCCGGGCACTTCTCAGCATGGCCATCTTCTCCACGGGCGTCTG
G
GTGACGGGCATCTTCTTCTTCCGCCAAACCCTGAAGCTGCTTCTCTGCTACCATGGGTGGATGTTTGAG
ATG
CATGGCAAGACCAGCAACTTGACCAGGATCTGGGCTATGTGTATCCGCCTTCTATCCAGCCGGCACC
CT
ATGCTCTACAGCTTCCAGACATCTCTGCCCAAGCTTCCTGTGCCCAGGGTGTCAGCCACAATTCAGCG
G
TACCTAGAGTCTGTGCGCCCCTTGTTGGATGATGAGGAATATTACCGCATGGAGTTGCTGGCCAAAGAA
TTC
CAGGACAAGACTGCCCCCAGGCTGCAGAAATACCTGGTGCTCAAGTCATGGTGGGCAAGTAACTATG
TG
AGTGACTGGTGGGAAGAGTACATCTACCTTCGAGGCAGGAGCCCTCTCATGGTGAACAGCAACTATTA
T
GTCATGGACCTTGTGCTCATCAAGAATACAGACGTGCAGGCAGCCCGCCTGGGAAACATCATCCACGCC
ATG
ATCATGTATCGCCGTAAACTGGACCGTGAAGAAATCAAGCCTGTGATGGCACTGGGCATAGTGCCTA
TG
TGCTCCTACCAGATGGAGAGGATGTTCAACACCACTCGGATCCCGGGCAAGGACACAGATGTGCTACA
G
CACCTCTCAGACAGCCGGCACGTGGCTGTCTACCACAAGGGACGCTTCTTCAAGCTGTGGCTCTATGAG
GGC
GCCCGTCTGCTCAAGCCTCAGGATCTGGAGATGCAGTTCCAGAGGATCCTGGACGACCCCTCCCCAC
CT
CAGCCTGGGGAGGAGAAGCTGGCAGCCCTCACTGCAGGAGGAAGGGTGGAGTGGGCGCAGGCACGCCA
G
GCCTTCTTTAGCTCTGGAAAGAATAAGGCTGCCTTGGAGGCCATCGAGCGTGCCGCTTTCTTCGTGGCC
CTG
GATGAGGAATCCTACTCCTATGACCCCGAAGATGAGGCCAGCCTCAGCCTCTATGGCAAGGCCCTGC
TA
CATGGCAACTGCTACAACAGGTGGTTTGACAAATCCTTCACTCTCATTTCCTTCAAGAATGGCCAGTT
G
GGTCTCAATGCAGAGCATGCGTGGGCAGATGCTCCCATCATTGGGCACCTCTGGGAGTTTGTCCTGGGC
ACA
GACAGCTTCCACCTGGGCTACACGGAGACCGGGCACTGCCTGGGCAAACCGAACCCTGCGCTCGCAC
CT
CCTACACGGCTGCAGTGGGACATTCCAAAACAGTGCCAGGCGGTCATCGAGAGTTCCTACCAGGTGGC
C
AAGGCGTTGGCAGACGACGTGGAGTTGTACTGCTTCCAGTTCCTGCCCTTTGGCAAAGGCCTCATCAAG
AAG
TGCCGGACCAGCCCTGATGCCTTTGTGCAGATCGCGCTGCAGCTGGCTCACTTCCGGGACAGGGGTA
AG
TTCTGCCTGACCTATGAGGCCTCAATGACCAGAATGTTCCGGGAGGGACGGACTGAGACTGTGCGTTC
C
TGTACCAGCGAGTCCACAGCCTTTGTGCAGGCCATGATGGAGGGGTCCCACACAAAAGCAGACCTGCGA
GAT
CTCTTCCAGAAGGCTGCTAAGAAGCACCAGAATATGTACCGCCTGGCCATGACCGGGGCAGGGATCG
AC
AGGCACCTCTTCTGCCTTTACTTGGTCTCCAAGTACCTAGGAGTCAGCTCTCCTTTCCTTGCTGAGGT
G
CTCTCGGAACCCTGGCGTCTCTCCACCAGCCAGATCCCCCAATCCCAGATCCGCATGTTCGACCCAGAG
CAG
CACCCCAATCACCTGGGCGCTGGAGGTGGCTTTGGCCCTGTAGCAGATGATGGCTATGGAGTTTCCT
AC
ATGATTGCAGGCGAGAACACGATCTTCTTCCACATCTCCAGCAAGTTCTCAAGCTCAGAGACGAACGC
C
CAGCGCTTTGGAAACCACATCCGCAAAGCCCTGCTGGACATTGCTGATCTTTTCCAAGTTCCCAAGGCC
TAC
AGCTGA


Translation (772 aa):
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVIMATV
G
SSFCNVDISLGLVSCIQRCLPQ
GCGPYQTPQTRALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFE
M
HGKTSNLTRIWA
MCIRLLSSRHPMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKE
F
QDKTAPRLQKYLVLKSWWASNY
VSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHA
M
IMYRRKLDREEIKP
VMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYE
G
ARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGG
RVEWAQARQAFFSSGKNKAALEAIERAAFFVA
L
DEESYSYDPEDEASLSLYGKALLHGNCYN
RWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLG
T
DSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQ
CQAVIESSYQVAKALADDVELYCFQFLPFGKGLIK
K
CRTSPDAFVQIALQLAHFR
DRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLR
D
LFQKAAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAE
VLSEPWRLSTSQIPQSQIRMFDPE
Q
HPNHLGAGGGFGP
VADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKA
Y
S




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser