NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS117.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
117.2 Public Homo sapiens 1 CORT 20 108 85 CCDS HistoryNCBI Gene:1325Re-query CCDS DB by CCDS ID:117.2Re-query CCDS DB by GeneID:1325See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 117.1
The coding region has been updated to shorten the N-terminus to one that is more supported by available conservation and functional data. The previous representation had an overextended N-terminus that lacked the expected signal peptide.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 117.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000377049 ENSP00000366248 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377049Link to Ensembl Protein Viewer:ENSP00000366248Re-query CCDS DB by Nucleotide ID:ENST00000377049Re-query CCDS DB by Protein ID:ENSP00000366248
Original member Current member EBI,WTSI OTTHUMT00000005410 OTTHUMP00000001901 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000005410Link to Vega Protein Viewer:OTTHUMP00000001901Re-query CCDS DB by Nucleotide ID:OTTHUMT00000005410Re-query CCDS DB by Protein ID:OTTHUMP00000001901
Original member Current member NCBI NM_001302.4 NP_001293.3 Accepted alive Link to Nucleotide Sequence:NM_001302.4Link to Protein Sequence:NP_001293.3Re-query CCDS DB by Nucleotide ID:NM_001302Re-query CCDS DB by Protein ID:NP_001293Link to BLAST:NP_001293.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001293.3 105 O00230 105 100% 0 0

Chromosomal Locations for CCDS 117.2

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 10450224 10450322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 10451377 10451595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (318 nt):
ATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCCCCTGG
AG
GGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGCCTCCT
G
ACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGGAAGCC
CGG
GAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCTGCGCGCCGGGACAGAATGCCCTGCA
GG
AACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAA


Translation (105 aa):
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEA
R
EVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser