NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7729.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7729.1 Public Homo sapiens 11 INS 20 108 85 CCDS HistoryNCBI Gene:3630Re-query CCDS DB by CCDS ID:7729.1Re-query CCDS DB by GeneID:3630See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7729.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000250971 ENSP00000250971 Accepted alive Link to Ensembl Transcript Viewer:ENST00000250971Link to Ensembl Protein Viewer:ENSP00000250971Re-query CCDS DB by Nucleotide ID:ENST00000250971Re-query CCDS DB by Protein ID:ENSP00000250971
Original member Current member EBI,WTSI ENST00000381330 ENSP00000370731 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381330Link to Ensembl Protein Viewer:ENSP00000370731Re-query CCDS DB by Nucleotide ID:ENST00000381330Re-query CCDS DB by Protein ID:ENSP00000370731
Original member Current member EBI,WTSI ENST00000397262 ENSP00000380432 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397262Link to Ensembl Protein Viewer:ENSP00000380432Re-query CCDS DB by Nucleotide ID:ENST00000397262Re-query CCDS DB by Protein ID:ENSP00000380432
Original member Current member EBI,WTSI OTTHUMT00000026393 OTTHUMP00000011161 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000026393Link to Vega Protein Viewer:OTTHUMP00000011161Re-query CCDS DB by Nucleotide ID:OTTHUMT00000026393Re-query CCDS DB by Protein ID:OTTHUMP00000011161
Original member Current member EBI,WTSI OTTHUMT00000026394 OTTHUMP00000011162 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000026394Link to Vega Protein Viewer:OTTHUMP00000011162Re-query CCDS DB by Nucleotide ID:OTTHUMT00000026394Re-query CCDS DB by Protein ID:OTTHUMP00000011162
Original member Current member EBI,WTSI OTTHUMT00000026395 OTTHUMP00000196038 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000026395Link to Vega Protein Viewer:OTTHUMP00000196038Re-query CCDS DB by Nucleotide ID:OTTHUMT00000026395Re-query CCDS DB by Protein ID:OTTHUMP00000196038
Original member Current member NCBI NM_000207.2 NP_000198.1 Accepted alive Link to Nucleotide Sequence:NM_000207.2Link to Protein Sequence:NP_000198.1Re-query CCDS DB by Nucleotide ID:NM_000207Re-query CCDS DB by Protein ID:NP_000198Link to BLAST:NP_000198.1
Original member Current member NCBI NM_001185097.1 NP_001172026.1 Accepted alive Link to Nucleotide Sequence:NM_001185097.1Link to Protein Sequence:NP_001172026.1Re-query CCDS DB by Nucleotide ID:NM_001185097Re-query CCDS DB by Protein ID:NP_001172026Link to BLAST:NP_001172026.1
Original member Current member NCBI NM_001185098.1 NP_001172027.1 Accepted alive Link to Nucleotide Sequence:NM_001185098.1Link to Protein Sequence:NP_001172027.1Re-query CCDS DB by Nucleotide ID:NM_001185098Re-query CCDS DB by Protein ID:NP_001172027Link to BLAST:NP_001172027.1
Original member Current member NCBI NM_001291897.1 NP_001278826.1 Accepted alive Link to Nucleotide Sequence:NM_001291897.1Link to Protein Sequence:NP_001278826.1Re-query CCDS DB by Nucleotide ID:NM_001291897Re-query CCDS DB by Protein ID:NP_001278826Link to BLAST:NP_001278826.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000198.1 110 P01308-1 110 100% 0 0
NP_001172026.1 110 P01308-1 110 100% 0 0
NP_001172027.1 110 P01308-1 110 100% 0 0
NP_001278826.1 110 P01308-1 110 100% 0 0

Chromosomal Locations for CCDS 7729.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 2159852 2159997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 2160785 2160971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (333 nt):
ATGGCCCTGTGGATGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAG
CC
TTTGTGAACCAACACCTGTGCGGCTCACACCTGGTGGAAGCTCTCTACCTAGTGTGCGGGGAACGAGG
C
TTCTTCTACACACCCAAGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGG
GGC
CCTGGTGCAGGCAGCCTGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAAC
AA
TGCTGTACCAGCATCTGCTCCCTCTACCAGCTGGAGAACTACTGCAACTAG


Translation (110 aa):
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
G
PGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser