NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41146.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41146.1 Public Mus musculus X Tbc1d8b 21 106 86 CCDS HistoryNCBI Gene:245638Re-query CCDS DB by CCDS ID:41146.1Re-query CCDS DB by GeneID:245638See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41146.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000096313 ENSMUSP00000094036 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000096313Link to Ensembl Protein Viewer:ENSMUSP00000094036Re-query CCDS DB by Nucleotide ID:ENSMUST00000096313Re-query CCDS DB by Protein ID:ENSMUSP00000094036
Original member Current member EBI,WTSI OTTMUST00000045064 OTTMUSP00000020255 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045064Link to Vega Protein Viewer:OTTMUSP00000020255Re-query CCDS DB by Nucleotide ID:OTTMUST00000045064Re-query CCDS DB by Protein ID:OTTMUSP00000020255
Original member Current member NCBI NM_001081499.2 NP_001074968.1 Accepted alive Link to Nucleotide Sequence:NM_001081499.2Link to Protein Sequence:NP_001074968.1Re-query CCDS DB by Nucleotide ID:NM_001081499Re-query CCDS DB by Protein ID:NP_001074968Link to BLink:NP_001074968.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074968.1 1114 A3KGB4 1114 100% 0 0

Chromosomal Locations for CCDS 41146.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 139685181 139685310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139700999 139701109 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139704602 139704720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139705956 139706181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139707117 139707357 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139712254 139712461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139713255 139713419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139723903 139724052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139725078 139725228 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139725664 139725878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139732258 139732375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139733955 139734240 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139736289 139736418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139736954 139737052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139741927 139741995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139742152 139742392 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139743356 139743421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139745208 139745291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139746351 139746407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139749948 139750045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 139751461 139751841 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3345 nt):
ATGTGGCTGAAGCCCGAGGAAGTGCTGTTGAAAAATGCGCTGAAGCTGTGGCTGATGGAAAGATCCAACG
AG
TACTTTGTCCTGCAAAGGCGTCGAGGCTACGGGGAAGAAGGAGGAGGGGGACTTACAGGGCTCTTGGT
T
GGGACTCTTGATTCTGTCTTAGACTCCACTGCTAAAGTAGCTCCATTTCGCATCCTACACCAGACACCA
GAT
TCTCAAGTGTACTTGTCAATTGCATGTGGAGCCAACAGAGAAGAAATAACAAAACATTGGGACTGGT
TG
GAACAAAATATAATGAAGACTTTATCTGTGTTTGATTCAAATGAAGATATTACCAATTTTGTACAAGG
C
AAAATAAGAGGACTAATCGCTGAAGAGGGGAAACAGTCTTTTGCTAAAGAAGATGATCCTGAGAAATTT
CGA
GAAGCCCTTTTGAAATTTGAAAAATCTTTTGGTTTACCAGAGCAGGAAAAATTAGTAACTTATTATT
CC
TGCAGTTACTGGAGAGGACGGGTCCCTTGTCAGGGCTGGCTCTATCTAAGTACCAACTTTCTGAGCTT
C
TATTCCTTCTTGCTAGGATCAGAAATTAAACTCATTATCTCCTGGGATGCAATCTCAAAACTTGAAAAG
ACT
TCAACTGTTATATTAACTGAGAGCATTCACGTATGTTCTCAAGGAGAGAATCACTATTTTTCAATGT
TT
TTGCACATTAATGAGACATACCTTCTTATGGAACAACTGGCAAACTATGCCATAAAGAGACTTTTTGA
T
AAAGAAACATTTGATAATGACCCAGTCCTTGATGATCCTCTACAGATTACCAAAAGAGGTTTGGAATAT
CGA
GCCCACAGTGAGCAATTCAAAGCCTTTTTTAGGCTACCCAAAGAAGAGACATTGAAAGAAGTACATG
AG
TGTTTCTTATGGGTACCATTCAGCCACTTCAGTAGTCACGGAAAAATGTGCATTTCAGAAAACTATAT
T
TGCTTTGCTAGCCAGGATGGGAATCTATGCAGTGTAATCATTCCATTACGAGAGGTCTTAGCTATAGAT
AAA
ACTGATGACTCCAACAGATCGGTCATCATTAGCATCAAAGGAAAAACAGCTTTTCGTTTCAGTGAGC
TT
AAAGACTTTGAGCAACTGGTGGCAAAACTCAGGCTCAAGTGCCGGGCAGCTTCAACTCAAGATGATGT
T
AGTACAGAGGTTGCTGTTAGTTCTGACTCGACAGGCCCATCTGAGAATTTTGAGGAGCAGCCTTTGACA
TGT
CCAAAGGAATGCAGCAAAACTGTGAACACTGAAGCCTTAATGACAGTATTTCACCCTCAAAATCTGG
AA
AATCTTGATTCTAAAATGTTGAAAGAAAAGATGAAGGAGCAATCATGGAACATCTTATTTTCAGAATG
T
GGGCGAGGTGTTAGCATGTTCCGGACAAAAAAGACTCGAGATCTGGTGGTAAGAGGGATTCCAGAGACG
TTA
AGAGGAGAGCTCTGGATGCTTTTCTCAGGTGCTGTTAATGACATGGCAACAAACCCTGGCTATTATG
CT
GAAGTGGTTGAGCAATCCTTAGGGACCTCCAACTTGGCTACTGAAGAAATTGAGCGTGATTTGCGTCG
C
TCTCTGCCCGAACATCCAGCATTTCAGAGTGATACTGGCATATCTGCTCTGAGGCGGGTACTGACAGCT
TAT
GCATATAGGAATCCCAAAATAGGATACTGCCAGGCAATGAACATTTTGACTTCAGTATTGCTCCTAT
AT
GCAAAAGAAGAAGAGGCTTTTTGGCTTCTGGTTGCTGTATGTGAACGAATGTTGCCTGATTATTTTAA
T
CGTCGAATCATTGGTGCCTTGGTGGACCAGGCAGTGTTTGAAGAACTTATCAGGGATCACCTTCCTCAG
CTG
ACAGACCACATGACCGACATGACTTTCTTTTCCTCTGTTTCTCTTTCCTGGTTTCTCACACTTTTCA
TT
AGTGTGCTACCTATTGAAAGTGCAGTGAATGTGGTGGACTGTTTCTTCTATGATGGAATAAAAGCCAT
T
TTACAACTGGGATTGGCAATACTTGACTATAATTTAGACAAACTTCTGACATGTAAAGATGATGCTGAA
GCG
GTGACGGCACTAAACAGGTTCTTTGACAATGTCATTAATAAGGATAGCCCACTGCCTTCAAATGTTC
AA
CAGGGTTCAAATATCAGTAATGAAAAAAGTGATCATACTAAAGTGGATATTACAGATTTGATTAAAGA
G
TCCAATGAGAAATATGGTAGTATCCGCTATGAAGATATACATAGCATGCGCTGTCGAAATAGGTTGTAT
GTG
ATCCAGACCCTGGAAGAGACAACAAAGCAGAATGTGCTACGTGTTGTATCGCAAGACGTGAAAATGA
GC
CTTCAGGAACTGGACGAACTTTATGTCATTTTTAAGAAAGAGCTGTTTATATCTTGTTATTGGTATTT
G
AGTTGTCCAGGATTGAAGCATCATGACCCCAGCCTGCCATATTTGGAACAATATCAGATTGACTGCCAG
CAA
TTCAGAGTATTATATCACTTGCTGAGTCCCTGGGCTCATTCTGCAAACAGAGACTCATTGGCTTTAT
GG
ACATTCCGATTGTTGGATGAGAACTCTGATTGCCTTATAAACTTCAAAGAATTCTCCTCTGCAATAGA
T
ATAATGTACAATGGAAGTTTTACTGACAAGCTCAAGCTGCTTTTTAAGCTGCATATTCCTCCAGCTTAT
ACT
GAAGTGATGTCTAAGACGTCTTCAAAGGGCGATGAGCTTTCAACAGAAGAATTACTTTATTTCAGTC
AG
CTCCAGGTTTCTAAGCCTGCAGATGAGAAGGAAACAGAATCGGGAAGAAATAGCCCTGAAAAAGGCAA
A
GGAAAAATTGATATTCAAGCCTATTTAAGTCAATGGCAAGATGAGCTTCTTAAAAAAGAAGAAACCATT
AAA
GATTTACCAAGAATGAATCAGTCACAATTTATTCAATTTTCAAAGACCCTGTATAATTTATTTCATG
AG
GACCCTGAAGAAGAGTCGCTATATCAAGCCATTGCTATTGTAACCAACCTTCTGCTCAGGATGGAAGA
A
GTTGGAAGGAAACTCCATAGCCCGGCATCATCAGCCAGTACAGCTCGTGATTCTGGACCCAGTGAAGGG
AAT
GCAGAGAGCAGTGTGAAGAAAGATCTTCCCTCTCCCAGGGAAGAACATCAGTGGTCGTTTGCATTTG
AG
CAGATTCTTGCTTCCCTGTTAAATGAACCAGCCTTGGTGAGGTTTTTTGAGAGACCCTTAGATTTAAA
A
GCCAAGCTAGAAAATGCGAAAAGCTCCCAGCTAAGGTCTAGAACCAAGATGTAA


Translation (1114 aa):
MWLKPEEVLLKNALKLWLMERSNEYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAPFRILHQTP
D
SQVYLSIAC
GANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRGLIAEEGKQSFAKEDDPEKF
R
EALLKFEKSFGLPEQEKLVTYYSCSYWRGRVPCQGWLYLSTNFLSFYSFLLGSE
IKLIISWDAISKLEK
T
STVILTESIHVCSQGENHYFSMFLHINETYLLMEQLANYAIKRLFDKETFDNDPVLDDPLQITK
RGLEY
R
AHSEQFKAFFRLPKEETLKEVHECFLWVPFSHFSSHGKMCISENYICFASQDGNLCSVIIPLRE
VLAID
K
TDDSNRSVIISIKGKTAFRFSELKDFEQLVAKLRLKCRAASTQDDVSTE
VAVSSDSTGPSENFEEQPLT
C
PKECSKTVNTEALMTVFHPQNLENLDSKM
LKEKMKEQSWNILFSECGRGVSMFRTKKTRDLVVRGIPET
L
RGELWMLFS
GAVNDMATNPGYYAEVVEQSLGTSNLATEEIERDLRRSLPEHPAFQSDTGISALRRVLTA
Y
AYRNPKIGYCQ
AMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQAVFEELIRDHLPQ
L
TDHMTDMTFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAE
A
VTALN
RFFDNVINKDSPLPSNVQQGSNISNEKSDHTKVDITDLIKESNEKYGSIRYEDIHSMRCRNRLY
V
IQTLEETTKQNV
LRVVSQDVKMSLQELDELYVIFKKELFISCYWYLSCPGLKHHDPSLPYLEQYQIDCQ
Q
FRVLYHLLSPWAHSANRDSLALWTFRLLDENSDCLINFKEFSSAI
DIMYNGSFTDKLKLLFKLHIPPAY
T
EVMSKTSSKGDELSTEELLYFSQLQ
VSKPADEKETESGRNSPEKGKGKIDIQAYLSQWQDELLKKEETI
K
DLPRMNQ
SQFIQFSKTLYNLFHEDPEEESLYQAIAIVTNLLLRMEEVGRKLHSPASSASTARDSGPSEG
N
AESSVKKDLPSPREEHQWSFAFEQILASLLNEPALVRFFERPLDLKAKLENAKSSQLRSRTKM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser