NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7138.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7138.1 Public Homo sapiens 10 BMI1 20 108 85 CCDS HistoryNCBI Gene:648Re-query CCDS DB by CCDS ID:7138.1Re-query CCDS DB by GeneID:648See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7138.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000376663 ENSP00000365851 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376663Link to Ensembl Protein Viewer:ENSP00000365851Re-query CCDS DB by Nucleotide ID:ENST00000376663Re-query CCDS DB by Protein ID:ENSP00000365851
Original member Current member EBI,WTSI OTTHUMT00000047176 OTTHUMP00000019290 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000047176Link to Vega Protein Viewer:OTTHUMP00000019290Re-query CCDS DB by Nucleotide ID:OTTHUMT00000047176Re-query CCDS DB by Protein ID:OTTHUMP00000019290
Original member Current member NCBI NM_005180.8 NP_005171.4 Accepted alive Link to Nucleotide Sequence:NM_005180.8Link to Protein Sequence:NP_005171.4Re-query CCDS DB by Nucleotide ID:NM_005180Re-query CCDS DB by Protein ID:NP_005171Link to BLink:NP_005171.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005171.4 326 P35226 326 100% 0 0

Chromosomal Locations for CCDS 7138.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 22326450 22326561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22326890 22326986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22327595 22327650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22327742 22327792 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22327950 22328058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22328134 22328179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22328600 22328698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22329048 22329128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 22329213 22329542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (981 nt):
ATGCATCGAACAACGAGAATCAAGATCACTGAGCTAAATCCCCACCTGATGTGTGTGCTTTGTGGAGGGT
AC
TTCATTGATGCCACAACCATAATAGAATGTCTACATTCCTTCTGTAAAACGTGTATTGTTCGTTACCT
G
GAGACCAGCAAGTATTGTCCTATTTGTGATGTCCAAGTTCACAAGACCAGACCACTACTGAATATAAGG
TCA
GATAAAACTCTCCAAGATATTGTATACAAATTAGTTCCAGGGCTTTTCAAAAATGAAATGAAGAGAA
GA
AGGGATTTTTATGCAGCTCATCCTTCTGCTGATGCTGCCAATGGCTCTAATGAAGATAGAGGAGAGGT
T
GCAGATGAAGATAAGAGAATTATAACTGATGATGAGATAATAAGCTTATCCATTGAATTCTTTGACCAG
AAC
AGATTGGATCGGAAAGTAAACAAAGACAAAGAGAAATCTAAGGAGGAGGTGAATGATAAAAGATACT
TA
CGATGCCCAGCAGCAATGACTGTGATGCACTTAAGAAAGTTTCTCAGAAGTAAAATGGACATACCTAA
T
ACTTTCCAGATTGATGTCATGTATGAGGAGGAACCTTTAAAGGATTATTATACACTAATGGATATTGCC
TAC
ATTTATACCTGGAGAAGGAATGGTCCACTTCCATTGAAATACAGAGTTCGACCTACTTGTAAAAGAA
TG
AAGATCAGTCACCAGAGAGATGGACTGACAAATGCTGGAGAACTGGAAAGTGACTCTGGGAGTGACAA
G
GCCAACAGCCCAGCAGGAGGTATTCCCTCCACCTCTTCTTGTTTGCCTAGCCCCAGTACTCCAGTGCAG
TCT
CCTCATCCACAGTTTCCTCACATTTCCAGTACTATGAATGGAACCAGCAACAGCCCCAGCGGTAACC
AC
CAATCTTCTTTTGCCAATAGACCTCGAAAATCATCAGTAAATGGGTCATCAGCAACTTCTTCTGGTTG
A


Translation (326 aa):
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR
S
DKTLQDIVYKLVPGLFK
NEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ
N
RLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA
Y
IYTWRR
NGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ
S
PHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser