NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27787.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27787.1 Public Mus musculus 15 Asb8 21 106 86 CCDS HistoryNCBI Gene:78541Re-query CCDS DB by CCDS ID:27787.1Re-query CCDS DB by GeneID:78541See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27787.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000059112 ENSMUSP00000057864 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059112Link to Ensembl Protein Viewer:ENSMUSP00000057864Re-query CCDS DB by Nucleotide ID:ENSMUST00000059112Re-query CCDS DB by Protein ID:ENSMUSP00000057864
Original member Current member EBI,WTSI ENSMUST00000143400 ENSMUSP00000115813 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000143400Link to Ensembl Protein Viewer:ENSMUSP00000115813Re-query CCDS DB by Nucleotide ID:ENSMUST00000143400Re-query CCDS DB by Protein ID:ENSMUSP00000115813
Original member Current member EBI,WTSI ENSMUST00000123922 ENSMUSP00000119481 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000123922Link to Ensembl Protein Viewer:ENSMUSP00000119481Re-query CCDS DB by Nucleotide ID:ENSMUST00000123922Re-query CCDS DB by Protein ID:ENSMUSP00000119481
Original member Current member EBI,WTSI ENSMUST00000123626 ENSMUSP00000121383 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000123626Link to Ensembl Protein Viewer:ENSMUSP00000121383Re-query CCDS DB by Nucleotide ID:ENSMUST00000123626Re-query CCDS DB by Protein ID:ENSMUSP00000121383
Original member Current member EBI,WTSI OTTMUST00000081445 OTTMUSP00000043584 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081445Link to Vega Protein Viewer:OTTMUSP00000043584Re-query CCDS DB by Nucleotide ID:OTTMUST00000081445Re-query CCDS DB by Protein ID:OTTMUSP00000043584
Original member Current member EBI,WTSI OTTMUST00000081446 OTTMUSP00000043585 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081446Link to Vega Protein Viewer:OTTMUSP00000043585Re-query CCDS DB by Nucleotide ID:OTTMUST00000081446Re-query CCDS DB by Protein ID:OTTMUSP00000043585
Original member Current member EBI,WTSI OTTMUST00000081447 OTTMUSP00000043586 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081447Link to Vega Protein Viewer:OTTMUSP00000043586Re-query CCDS DB by Nucleotide ID:OTTMUST00000081447Re-query CCDS DB by Protein ID:OTTMUSP00000043586
Original member Current member EBI,WTSI OTTMUST00000081448 OTTMUSP00000043587 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081448Link to Vega Protein Viewer:OTTMUSP00000043587Re-query CCDS DB by Nucleotide ID:OTTMUST00000081448Re-query CCDS DB by Protein ID:OTTMUSP00000043587
Original member Current member NCBI NM_001170710.1 NP_001164181.1 Accepted alive Link to Nucleotide Sequence:NM_001170710.1Link to Protein Sequence:NP_001164181.1Re-query CCDS DB by Nucleotide ID:NM_001170710Re-query CCDS DB by Protein ID:NP_001164181Link to BLink:NP_001164181.1
Original member Current member NCBI NM_001170711.1 NP_001164182.1 Accepted alive Link to Nucleotide Sequence:NM_001170711.1Link to Protein Sequence:NP_001164182.1Re-query CCDS DB by Nucleotide ID:NM_001170711Re-query CCDS DB by Protein ID:NP_001164182Link to BLink:NP_001164182.1
Original member Current member NCBI NM_030121.4 NP_084397.3 Accepted alive Link to Nucleotide Sequence:NM_030121.4Link to Protein Sequence:NP_084397.3Re-query CCDS DB by Nucleotide ID:NM_030121Re-query CCDS DB by Protein ID:NP_084397Link to BLink:NP_084397.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001164181.1 288 Q91ZT9 288 99.6528% 0 1
NP_001164182.1 288 Q91ZT9 288 99.6528% 0 1
NP_084397.3 288 Q91ZT9 288 99.6528% 0 1

Chromosomal Locations for CCDS 27787.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 98135806 98136438 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98141284 98141388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98142651 98142779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (867 nt):
ATGAGTTCCAGCATGTGGTATATTATGCAGAGCATTCAGAGCAAATACTCCCTCTCCGAACGCCTGATCC
GA
ACCATCGCTGCCATCCGCTCCTTCCCACATGACAACGTAGAGGACCTCATCAGAGGGGGAGCAGATGT
G
AACTGCACGCACGGCACACTGAAGCCCCTCCACTGTGCCTGCATGGTGTCCGACGCCGACTGCGTAGAG
CTC
CTCCTGGAGAAGGGAGCAGAGGTCAATGCCCTGGATGGTTACAACCGAACGGCCCTCCACTATGCAG
CA
GAGAAAGATGAGGCTTGTGTGGAGGTCCTACTGGAGTATGGGGCAAACCCCAATGCACTGGACGGCAA
C
AGAGACACCCCGCTTCATTGGGCAGCCTTTAAGAACAATGCTGAGTGTGTGCGGGCTCTCCTGGAGAGC
GGG
GCCTCCGTCAATGCCCTGGATTACAACAACGATACGCCGCTCAGCTGGGCTGCCATGAAGGGAAATC
TT
GAGAGTGTCAGCATCCTTCTTGATTATGGTGCTGAGGTCAGAGTCATCAACTTAAAAGGCCAGACACC
C
ATCTCCCGCCTGGTGGCTCTGCTAGTGAGAGGACTTGGAACAGAAAAAGAAGACTCCTGCTTTGAGCTC
CTC
CATAGAGCTGTTGGACAGTTTGAATTAAGGAAAAACGGCATCATGCCCCGAGAAGTGACCAAAGACC
AG
CAGCTGTGTGAAAAACTGACTGTGTTGTGCTCAGCACCAGGGACGCTTAAAACCCTCGCCCGCTATGC
T
GTGCGCCGTAGCCTCGGTCTCCAGTACCTGCCCGACGCAGTGAAGGGTCTCCCACTGCCAGTGTCTTTG
AAG
GACTACCTGTTACTCTTGGAGTAG


Translation (288 aa):
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCACMVSDADCVE
L
LLEKGAE
VNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDTPLHWAAFKNNAECVRALLES
G
ASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVINLKGQTPISRLVALLVRGLGTEKEDSCFEL
L
HRAVGQFELRKNGIMPREVTKDQQLCEKLTVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPVSL
K
DYLLLLE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser