NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS33400.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33400.1 Public Homo sapiens 2 CHRNG 20 108 85 CCDS HistoryNCBI Gene:1146Re-query CCDS DB by CCDS ID:33400.1Re-query CCDS DB by GeneID:1146See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33400.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000389494 ENSP00000374145 Accepted alive Link to Ensembl Transcript Viewer:ENST00000389494Link to Ensembl Protein Viewer:ENSP00000374145Re-query CCDS DB by Nucleotide ID:ENST00000389494Re-query CCDS DB by Protein ID:ENSP00000374145
Original member Current member EBI,WTSI OTTHUMT00000330743 OTTHUMP00000203703 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000330743Link to Vega Protein Viewer:OTTHUMP00000203703Re-query CCDS DB by Nucleotide ID:OTTHUMT00000330743Re-query CCDS DB by Protein ID:OTTHUMP00000203703
Original member Current member NCBI NM_005199.4 NP_005190.4 Accepted alive Link to Nucleotide Sequence:NM_005199.4Link to Protein Sequence:NP_005190.4Re-query CCDS DB by Nucleotide ID:NM_005199Re-query CCDS DB by Protein ID:NP_005190Link to BLAST:NP_005190.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005190.4 517 P07510-1 517 100% 0 0

Chromosomal Locations for CCDS 33400.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 232539748 232539802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232539992 232540131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232540381 232540425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232540602 232540711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232541374 232541529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232542423 232542520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232542882 232543082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232543275 232543389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232543585 232543699 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232544367 232544580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232544772 232544902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 232545543 232545716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1554 nt):
ATGCATGGGGGCCAGGGGCCGCTGCTCCTCCTGCTGCTGCTGGCTGTCTGCCTGGGGGCCCAGGGCCGGA
AC
CAGGAGGAGCGCCTGCTCGCAGACCTGATGCAAAACTACGACCCCAACCTGCGGCCCGCGGAACGAGA
C
TCGGATGTGGTCAATGTCAGCCTGAAGCTAACCCTCACCAACCTCATCTCCCTGAACGAGCGAGAGGAA
GCC
CTCACCACCAATGTCTGGATAGAGATGCAGTGGTGCGACTATCGCCTGCGCTGGGATCCGCGAGACT
AC
GAAGGCCTGTGGGTGCTGAGGGTGCCGTCCACCATGGTGTGGCGGCCGGATATCGTGCTGGAGAACAA
C
GTGGACGGTGTCTTCGAGGTGGCCCTCTACTGCAATGTGCTCGTGTCCCCTGACGGCTGTATCTACTGG
CTG
CCGCCTGCCATCTTCCGTTCCGCCTGCTCTATCTCAGTCACCTACTTCCCCTTCGACTGGCAGAACT
GC
TCCCTTATCTTCCAGTCCCAGACTTACAGCACCAATGAGATTGATCTGCAGCTGAGTCAGGAAGATGG
C
CAGACCATCGAGTGGATTTTCATTGACCCTGAGGCCTTCACAGAGAATGGGGAGTGGGCCATCCAGCAC
CGA
CCAGCCAAGATGCTCCTGGACCCAGCGGCGCCAGCCCAGGAAGCAGGCCACCAGAAGGTGGTGTTCT
AC
CTGCTCATCCAGCGCAAGCCCCTCTTCTACGTCATCAACATCATCGCCCCCTGTGTGCTCATCTCCTC
T
GTCGCCATCCTCATCCACTTCCTTCCTGCCAAGGCTGGGGGCCAGAAGTGTACCGTCGCCATCAACGTG
CTC
CTGGCCCAGACTGTCTTCCTCTTCCTTGTGGCCAAGAAGGTGCCTGAAACCTCCCAGGCGGTGCCAC
TC
ATCAGCAAGTACCTGACCTTCCTCCTGGTGGTGACCATCCTCATTGTCGTGAATGCTGTGGTTGTGCT
C
AATGTCTCCTTGCGGTCTCCACACACACACTCCATGGCCCGAGGGGTCCGCAAGGTGTTCCTGAGGCTC
TTG
CCCCAGCTGCTGAGGATGCACGTTCGCCCGCTGGCCCCGGCAGCTGTGCAGGACACCCAGTCCCGGC
TA
CAGAATGGCTCCTCGGGATGGTCGATCACAACTGGGGAGGAGGTGGCCCTCTGCCTGCCTCGCAGTGA
A
CTCCTCTTCCAGCAGTGGCAGCGGCAAGGGCTGGTGGCGGCAGCGCTGGAGAAGCTAGAGAAAGGCCCG
GAG
TTAGGGCTGAGCCAGTTCTGTGGCAGCCTGAAGCAGGCTGCCCCAGCCATCCAGGCCTGTGTGGAAG
CC
TGCAACCTCATTGCCTGTGCCCGGCACCAGCAGAGTCACTTTGACAATGGGAATGAGGAGTGGTTCCT
G
GTGGGCCGAGTGCTGGACCGCGTCTGCTTCCTGGCCATGCTCTCGCTCTTCATCTGTGGCACAGCTGGC
ATC
TTCCTCATGGCCCACTACAACCGGGTGCCGGCCCTGCCATTCCCTGGAGATCCACGCCCCTACCTGC
CC
TCACCAGACTGA


Translation (517 aa):
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREE
A
LTTNVWIEM
QWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYW
L
PPAIFRSACSISVTYFPFDWQNCSLIF
QSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQH
R
PAKMLLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAK
AGGQKCTVAINV
L
LAQTVFLFLVAKKVPETSQAVPLIS
KYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRL
L
PQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKL
EKGP
E
LGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDN
GNEEWFLVGRVLDRVCFLAMLSLFICGTAG
I
FLMAHYNRVPALPFPGDPRPYLPSPD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser