NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1313.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1313.1 Public Homo sapiens 1 SERPINC1 20 108 85 CCDS HistoryNCBI Gene:462Re-query CCDS DB by CCDS ID:1313.1Re-query CCDS DB by GeneID:462See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1313.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000367698 ENSP00000356671 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367698Link to Ensembl Protein Viewer:ENSP00000356671Re-query CCDS DB by Nucleotide ID:ENST00000367698Re-query CCDS DB by Protein ID:ENSP00000356671
Original member Current member EBI,WTSI OTTHUMT00000090734 OTTHUMP00000035393 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000090734Link to Vega Protein Viewer:OTTHUMP00000035393Re-query CCDS DB by Nucleotide ID:OTTHUMT00000090734Re-query CCDS DB by Protein ID:OTTHUMP00000035393
Original member Current member NCBI NM_000488.3 NP_000479.1 Accepted alive Link to Nucleotide Sequence:NM_000488.3Link to Protein Sequence:NP_000479.1Re-query CCDS DB by Nucleotide ID:NM_000488Re-query CCDS DB by Protein ID:NP_000479Link to BLink:NP_000479.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000479.1 464 P01008 464 100% 0 0

Chromosomal Locations for CCDS 1313.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 173903889 173904065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173907450 173907514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173909552 173909942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173910754 173910891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173911799 173912014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173914553 173914919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 173917219 173917259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1395 nt):
ATGTATTCCAATGTGATAGGAACTGTAACCTCTGGAAAAAGGAAGGTTTATCTTTTGTCCTTGCTGCTCA
TT
GGCTTCTGGGACTGCGTGACCTGTCACGGGAGCCCTGTGGACATCTGCACAGCCAAGCCGCGGGACAT
T
CCCATGAATCCCATGTGCATTTACCGCTCCCCGGAGAAGAAGGCAACTGAGGATGAGGGCTCAGAACAG
AAG
ATCCCGGAGGCCACCAACCGGCGTGTCTGGGAACTGTCCAAGGCCAATTCCCGCTTTGCTACCACTT
TC
TATCAGCACCTGGCAGATTCCAAGAATGACAATGATAACATTTTCCTGTCACCCCTGAGTATCTCCAC
G
GCTTTTGCTATGACCAAGCTGGGTGCCTGTAATGACACCCTCCAGCAACTGATGGAGGTATTTAAGTTT
GAC
ACCATATCTGAGAAAACATCTGATCAGATCCACTTCTTCTTTGCCAAACTGAACTGCCGACTCTATC
GA
AAAGCCAACAAATCCTCCAAGTTAGTATCAGCCAATCGCCTTTTTGGAGACAAATCCCTTACCTTCAA
T
GAGACCTACCAGGACATCAGTGAGTTGGTATATGGAGCCAAGCTCCAGCCCCTGGACTTCAAGGAAAAT
GCA
GAGCAATCCAGAGCGGCCATCAACAAATGGGTGTCCAATAAGACCGAAGGCCGAATCACCGATGTCA
TT
CCCTCGGAAGCCATCAATGAGCTCACTGTTCTGGTGCTGGTTAACACCATTTACTTCAAGGGCCTGTG
G
AAGTCAAAGTTCAGCCCTGAGAACACAAGGAAGGAACTGTTCTACAAGGCTGATGGAGAGTCGTGTTCA
GCA
TCTATGATGTACCAGGAAGGCAAGTTCCGTTATCGGCGCGTGGCTGAAGGCACCCAGGTGCTTGAGT
TG
CCCTTCAAAGGTGATGACATCACCATGGTCCTCATCTTGCCCAAGCCTGAGAAGAGCCTGGCCAAGGT
A
GAGAAGGAACTCACCCCAGAGGTGCTGCAAGAGTGGCTGGATGAATTGGAGGAGATGATGCTGGTGGTC
CAC
ATGCCCCGCTTCCGCATTGAGGACGGCTTCAGTTTGAAGGAGCAGCTGCAAGACATGGGCCTTGTCG
AT
CTGTTCAGCCCTGAAAAGTCCAAACTCCCAGGTATTGTTGCAGAAGGCCGAGATGACCTCTATGTCTC
A
GATGCATTCCATAAGGCATTTCTTGAGGTAAATGAAGAAGGCAGTGAAGCAGCTGCAAGTACCGCTGTT
GTG
ATTGCTGGCCGTTCGCTAAACCCCAACAGGGTGACTTTCAAGGCCAACAGGCCTTTCCTGGTTTTTA
TA
AGAGAAGTTCCTCTGAACACTATTATCTTCATGGGCAGAGTAGCCAACCCTTGTGTTAAGTAA


Translation (464 aa):
MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQ
K
IPEATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLME
VFKF
D
TISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFK
EN
A
EQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFK
GLWKSKFSPENTRKELFYKADGESCS
A
SMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVV
H
MPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLP
GIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAV
V
IAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser