NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14099.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14099.1 Public Homo sapiens 22 CHKB 20 108 85 CCDS HistoryNCBI Gene:1120Re-query CCDS DB by CCDS ID:14099.1Re-query CCDS DB by GeneID:1120See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14099.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000406938 ENSP00000384400 Accepted alive Link to Ensembl Transcript Viewer:ENST00000406938Link to Ensembl Protein Viewer:ENSP00000384400Re-query CCDS DB by Nucleotide ID:ENST00000406938Re-query CCDS DB by Protein ID:ENSP00000384400
Original member Current member EBI,WTSI OTTHUMT00000317267 OTTHUMP00000196839 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317267Link to Vega Protein Viewer:OTTHUMP00000196839Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317267Re-query CCDS DB by Protein ID:OTTHUMP00000196839
Original member Current member NCBI NM_005198.4 NP_005189.2 Accepted alive Link to Nucleotide Sequence:NM_005198.4Link to Protein Sequence:NP_005189.2Re-query CCDS DB by Nucleotide ID:NM_005198Re-query CCDS DB by Protein ID:NP_005189Link to BLAST:NP_005189.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005189.2 395 Q9Y259-1 395 100% 0 0

Chromosomal Locations for CCDS 14099.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 50579181 50579255 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50579426 50579507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50579727 50579830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50579974 50580082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50580190 50580271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50580358 50580416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50580565 50580660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50581420 50581553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50581749 50581862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50582249 50582357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 50582558 50582781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1188 nt):
ATGGCGGCCGAGGCGACAGCTGTGGCCGGAAGCGGGGCTGTTGGCGGCTGCCTGGCCAAAGACGGCTTGC
AG
CAGTCTAAGTGCCCGGACACTACCCCAAAACGGCGGCGCGCCTCGTCGCTGTCGCGTGACGCCGAGCG
C
CGAGCCTACCAATGGTGCCGGGAGTACTTGGGCGGGGCCTGGCGCCGAGTGCAGCCCGAGGAGCTGAGG
GTT
TACCCCGTGAGCGGAGGCCTCAGCAACCTGCTCTTCCGCTGCTCGCTCCCGGACCACCTGCCCAGCG
TT
GGCGAGGAGCCCCGGGAGGTGCTTCTGCGGCTGTACGGAGCCATCTTGCAGGGCGTGGACTCCCTGGT
G
CTAGAAAGCGTGATGTTCGCCATACTTGCGGAGCGGTCGCTGGGGCCCCAGCTGTACGGAGTCTTCCCA
GAG
GGCCGGCTGGAACAGTACATCCCAAGTCGGCCATTGAAAACTCAAGAGCTTCGAGAGCCAGTGTTGT
CA
GCAGCCATTGCCACGAAGATGGCGCAATTTCATGGCATGGAGATGCCTTTCACCAAGGAGCCCCACTG
G
CTGTTTGGGACCATGGAGCGGTACCTAAAACAGATCCAGGACCTGCCCCCAACTGGCCTCCCTGAGATG
AAC
CTGCTGGAGATGTACAGCCTGAAGGATGAGATGGGCAACCTCAGGAAGTTACTAGAGTCTACCCCAT
CG
CCAGTCGTCTTCTGCCACAATGACATCCAGGAAGGGAACATCTTGCTGCTCTCAGAGCCAGAAAATGC
T
GACAGCCTCATGCTGGTGGACTTCGAGTACAGCAGTTATAACTATAGGGGCTTTGACATTGGGAACCAT
TTT
TGTGAGTGGGTTTATGATTATACTCACGAGGAATGGCCTTTCTACAAAGCAAGGCCCACAGACTACC
CC
ACTCAAGAACAGCAGTTGCATTTTATTCGTCATTACCTGGCAGAGGCAAAGAAAGGTGAGACCCTCTC
C
CAAGAGGAGCAGAGAAAACTGGAAGAAGATTTGCTGGTAGAAGTCAGTCGGTATGCTCTGGCATCCCAT
TTC
TTCTGGGGTCTGTGGTCCATCCTCCAGGCATCCATGTCCACCATAGAATTTGGTTACTTGGACTATG
CC
CAGTCTCGGTTCCAGTTCTACTTCCAGCAGAAGGGGCAGCTGACCAGTGTCCACTCCTCATCCTGA


Translation (395 aa):
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR
V
YPV
SGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFP
E
GRLEQYIP
SRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEM
N
LLEMYSLKDEMGNL
RKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH
F
CEWVYDYTHEEWPFYKARPTDYPTQEQQ
LHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASH
F
FWGLWSILQASMSTIEFGYL
DYAQSRFQFYFQQKGQLTSVHSSS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser