NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3920.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3920.1 Public Homo sapiens 5 NIPBL 20 108 85 CCDS HistoryNCBI Gene:25836Re-query CCDS DB by CCDS ID:3920.1Re-query CCDS DB by GeneID:25836See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3920.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000282516 ENSP00000282516 Accepted alive Link to Ensembl Transcript Viewer:ENST00000282516Link to Ensembl Protein Viewer:ENSP00000282516Re-query CCDS DB by Nucleotide ID:ENST00000282516Re-query CCDS DB by Protein ID:ENSP00000282516
Original member Current member EBI,WTSI OTTHUMT00000207582 OTTHUMP00000116005 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000207582Link to Vega Protein Viewer:OTTHUMP00000116005Re-query CCDS DB by Nucleotide ID:OTTHUMT00000207582Re-query CCDS DB by Protein ID:OTTHUMP00000116005
Original member Current member NCBI NM_133433.3 NP_597677.2 Accepted alive Link to Nucleotide Sequence:NM_133433.3Link to Protein Sequence:NP_597677.2Re-query CCDS DB by Nucleotide ID:NM_133433Re-query CCDS DB by Protein ID:NP_597677Link to BLAST:NP_597677.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_597677.2 2804 Q6KC79-1 2804 100% 0 0

Chromosomal Locations for CCDS 3920.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 36953697 36953760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36955472 36955637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36958104 36958231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36961484 36961583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36962123 36962274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36970876 36971036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36971945 36972041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36975776 36976402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36984676 36986301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 36995622 36995804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37000373 37000570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37000817 37000888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37000989 37001078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37002662 37002765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37003261 37003347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37006357 37006588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37007323 37007474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37008008 37008088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37008623 37008723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37010087 37010225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37014683 37014765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37016038 37016170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37017019 37017162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37019311 37019400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37020459 37020673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37020775 37020877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37022051 37022149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37022244 37022390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37024585 37024719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37026229 37026327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37027359 37027412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37036379 37036487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37038602 37038738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37044347 37044487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37044636 37044729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37045443 37045597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37046109 37046199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37048502 37048675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37049111 37049301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37051779 37051886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37052366 37052566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37057186 37057332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37058891 37059165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37060844 37061018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37063790 37063978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37064527 37064892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8415 nt):
ATGAATGGGGATATGCCCCATGTCCCCATTACTACTCTTGCGGGGATTGCTAGTCTCACAGACCTCCTGA
AC
CAGCTGCCTCTTCCATCTCCTTTACCTGCTACAACTACAAAGAGCCTTCTCTTTAATGCACGAATAGC
A
GAAGAGGTGAACTGCCTTTTGGCTTGTAGGGATGACAATTTGGTTTCACAGCTTGTCCATAGCCTCAAC
CAG
GTATCAACAGATCACATAGAGTTGAAAGATAACCTTGGCAGTGATGACCCAGAAGGTGACATACCAG
TC
TTGTTGCAGGCCGTCCTGGCAAGGAGTCCTAATGTTTTCAGGGAGAAAAGCATGCAGAACAGATATGT
A
CAAAGTGGAATGATGATGTCTCAGTATAAACTTTCTCAGAATTCCATGCACAGTAGTCCTGCATCTTCC
AAT
TATCAACAAACCACTATCTCACATAGCCCCTCCAGCCGGTTTGTGCCACCACAGACAAGCTCTGGGA
AC
AGATTTATGCCACAGCAAAATAGCCCAGTGCCTAGTCCATACGCCCCACAAAGCCCTGCAGGATACAT
G
CCATATTCCCATCCTTCAAGTTACACAACACATCCACAGATGCAACAAGCATCGGTATCAAGTCCCATT
GTT
GCAGGTGGTTTGAGAAACATACATGATAATAAAGTTTCTGGTCCGTTGTCTGGCAATTCAGCTAATC
AT
CATGCTGATAATCCTAGACATGGTTCAAGTGAGGACTACCTACACATGGTGCACAGGCTAAGTAGTGA
C
GATGGAGATTCTTCAACAATGAGGAATGCTGCATCTTTTCCCTTGAGATCTCCACAGCCAGTATGCTCC
CCT
GCTGGAAGTGAAGGAACTCCTAAAGGCTCAAGACCACCTTTAATCCTACAATCTCAGTCTCTACCTT
GT
TCATCACCTCGAGATGTTCCACCAGATATCTTGCTAGATTCTCCAGAAAGAAAACAAAAGAAGCAGAA
G
AAAATGAAATTAGGCAAGGATGAAAAAGAGCAGAGTGAGAAAGCGGCAATGTATGATATAATTAGTTCT
CCA
TCCAAGGACTCTACTAAACTTACATTAAGACTTTCTCGTGTAAGGTCTTCAGACATGGACCAGCAAG
AG
GATATGATTTCTGGTGTGGAAAATAGCAATGTTTCAGAAAATGATATTCCTTTTAATGTGCAGTACCC
A
GGACAGACTTCAAAAACACCCATTACTCCACAAGATATAAACCGCCCACTAAATGCTGCTCAATGTTTG
TCG
CAGCAAGAACAAACAGCATTCCTTCCAGCAAATCAAGTGCCTGTTTTACAACAGAACACTTCAGTTG
CT
GCAAAACAACCCCAGACTTCTGTGGTACAGAATCAACAACAGATATCACAACAGGGACCTATATATGA
T
GAAGTGGAATTGGATGCATTGGCTGAAATTGAGCGAATAGAGAGAGAATCAGCTATTGAAAGGGAGCGC
TTC
TCAAAAGAAGTTCAAGATAAAGATAAGCCTTTGAAAAAAAGAAAACAAGATTCTTACCCACAGGAGG
CT
GGGGGTGCTACAGGAGGTAATAGACCAGCTTCTCAGGAGACGGGTTCTACGGGAAATGGGTCAAGGCC
A
GCATTAATGGTTAGCATTGATCTTCATCAGGCAGGAAGAGTGGACTCTCAGGCTTCTATAACTCAGGAT
TCA
GACTCCATAAAAAAGCCTGAAGAAATCAAACAATGTAATGATGCACCTGTTTCTGTTCTTCAGGAAG
AT
ATTGTTGGAAGTCTTAAATCTACACCAGAAAACCATCCTGAGACACCTAAAAAAAAGTCTGATCCTGA
G
CTTTCAAAGAGTGAAATGAAACAAAGTGAAAGTAGATTAGCAGAATCTAAACCAAATGAAAACCGATTG
GTG
GAGACAAAATCAAGTGAAAATAAGTTAGAAACTAAAGTTGAGACCCAAACAGAAGAACTTAAACAGA
AT
GAGAGCAGAACAACTGAATGCAAACAAAACGAGAGCACCATAGTTGAGCCTAAACAAAATGAAAATAG
A
CTGTCTGACACAAAACCAAATGACAACAAACAAAATAATGGCAGATCAGAAACAACAAAATCAAGGCCT
GAA
ACCCCAAAGCAAAAGGGTGAAAGCCGGCCTGAGACTCCAAAACAAAAGAGTGATGGGCATCCTGAAA
CC
CCAAAACAGAAGGGTGATGGAAGGCCTGAAACTCCAAAGCAAAAAGGTGAGAGCCGCCCTGAAACTCC
A
AAGCAAAAAAATGAAGGGCGACCTGAAACACCAAAACACAGGCATGACAATAGGAGGGATTCTGGAAAG
CCA
TCTACAGAGAAAAAACCTGAAGTGTCTAAACATAAACAAGATACTAAATCTGACTCACCTCGGTTAA
AA
TCAGAACGAGCTGAAGCCTTAAAGCAGAGACCTGATGGGCGATCTGTTTCTGAGTCACTAAGACGTGA
C
CATGATAATAAACAAAAATCAGATGACAGGGGTGAATCAGAGCGACATCGAGGGGATCAGTCTAGGGTT
CGA
AGACCAGAAACATTGAGATCCTCTAGTAGAAATGAACATGGCATTAAATCTGATAGTTCAAAAACTG
AT
AAACTAGAACGAAAACACAGGCATGAATCAGGGGACTCAAGGGAAAGACCATCTTCTGGGGAACAAAA
A
TCAAGACCTGACAGTCCTCGTGTTAAACAAGGAGATTCTAATAAATCAAGATCTGATAAACTTGGTTTT
AAA
TCACCAACTAGTAAAGATGACAAAAGGACAGAGGGTAACAAGAGTAAAGTAGACACTAATAAAGCAC
AC
CCTGACAATAAGGCAGAATTTCCAAGTTATTTGTTGGGGGGCAGGTCTGGTGCGTTGAAAAATTTTGT
C
ATTCCGAAAATCAAGAGGGATAAAGATGGCAATGTTACTCAGGAGACAAAGAAAATGGAAATGAAAGGA
GAG
CCGAAAGACAAAGTAGAAAAAATAGGATTAGTTGAAGATCTAAATAAAGGAGCTAAGCCTGTAGTTG
TG
CTACAAAAACTGTCTTTGGATGATGTTCAGAAACTTATTAAAGATAGAGAGGACAAATCAAGAAGTTC
C
CTTAAACCTATCAAGAATAAACCATCAAAGTCAAATAAAGGTAGTATAGATCAATCAGTGTTAAAAGAA
TTA
CCCCCTGAACTCCTGGCAGAAATTGAGTCCACCATGCCACTTTGTGAACGTGTGAAAATGAACAAAC
GC
AAGCGTAGCACAGTTAATGAAAAGCCAAAATATGCTGAAATCAGTTCAGATGAAGATAATGATAGTGA
T
GAAGCTTTTGAATCCTCTAGGAAACGACATAAAAAAGATGATGATAAAGCTTGGGAATATGAAGAGCGT
GAC
AGAAGAAGCTCTGGGGATCATAGGAGAAGTGGCCACTCTCATGAAGGAAGAAGGAGTTCAGGTGGTG
GT
CGTTATCGAAACCGAAGTCCGTCAGATTCTGACATGGAAGATTATTCTCCTCCTCCCAGCCTTAGTGA
G
GTTGCTAGGAAAATGAAGAAAAAAGAAAAACAGAAGAAAAGGAAAGCATATGAACCAAAACTAACACCT
GAA
GAAATGATGGACTCTTCAACTTTTAAGAGATTCACAGCCTCAATAGAGAATATTTTGGATAATTTGG
AA
GATATGGATTTTACTGCGTTTGGTGATGATGATGAAATTCCTCAGGAACTGCTCTTAGGAAAACATCA
G
CTTAATGAACTTGGCAGTGAATCTGCTAAAATAAAAGCAATGGGTATAATGGATAAGCTTTCAACTGAC
AAA
ACTGTGAAAGTCTTAAATATCTTGGAGAAGAATATTCAGGATGGGTCAAAGCTTTCCACTTTGTTAA
AT
CATAATAACGATACTGAAGAAGAAGAAAGGTTATGGAGAGACCTTATTATGGAGAGAGTTACAAAATC
A
GCGGATGCTTGTCTTACAACTATCAACATTATGACATCCCCTAACATGCCAAAAGCTGTGTACATTGAG
GAT
GTAATTGAAAGAGTTATACAGTACACTAAATTTCATTTGCAGAATACACTTTATCCTCAGTATGATC
CT
GTTTACAGATTAGATCCTCATGGAGGAGGCTTATTAAGTTCAAAAGCAAAACGGGCTAAATGTTCTAC
C
CATAAGCAGAGAGTAATAGTAATGCTTTATAACAAAGTTTGTGACATTGTTAGCAGCTTATCAGAATTG
CTA
GAGATACAACTTCTTACAGACACAACAATTCTTCAGGTTTCATCTATGGGAATAACACCATTTTTTG
TG
GAAAATGTCAGTGAACTACAGTTGTGTGCCATTAAGTTAGTCACTGCAGTATTCTCAAGATATGAAAA
A
CATAGGCAGTTAATTTTGGAAGAAATTTTTACTTCACTTGCAAGATTACCAACCAGCAAGAGGAGTTTA
AGG
AACTTCAGGTTAAACAGTAGTGATATGGATGGAGAACCTATGTATATTCAGATGGTTACAGCACTGG
TT
TTACAACTTATTCAGTGTGTGGTACACTTACCATCATCAGAGAAGGACTCTAATGCAGAAGAAGATTC
A
AATAAAAAAATTGACCAGGATGTTGTCATTACTAACTCTTATGAAACAGCTATGCGAACAGCCCAAAAC
TTC
CTCTCCATCTTCCTTAAAAAATGTGGTAGTAAGCAAGGTGAAGAAGATTACAGACCACTGTTTGAAA
AT
TTTGTTCAAGACCTTCTTTCAACAGTCAATAAGCCTGAATGGCCAGCTGCTGAACTACTCCTTAGTTT
G
TTAGGGAGACTGTTGGTTCATCAGTTCAGTAACAAGTCAACAGAGATGGCTTTAAGAGTGGCATCTCTT
GAT
TACCTTGGAACTGTTGCTGCACGGCTAAGAAAAGATGCTGTTACAAGCAAAATGGATCAAGGATCTA
TA
GAACGCATTTTAAAACAGGTTTCAGGAGGGGAAGATGAAATCCAACAATTACAAAAAGCATTGCTTGA
T
TACTTGGATGAAAACACTGAGACTGATCCTTCACTAGTGTTTTCTCGTAAATTCTATATAGCCCAGTGG
TTT
CGAGACACAACTCTGGAAACAGAAAAAGCAATGAAATCACAAAAAGATGAAGAATCATCTGAAGGAA
CA
CATCATGCAAAGGAAATTGAGACAACTGGCCAAATTATGCATCGAGCTGAAAACCGAAAAAAGTTTCT
T
AGAAGCATTATCAAAACCACACCTTCTCAGTTTAGCACATTAAAGATGAACTCTGATACTGTGGACTAT
GAT
GATGCTTGCTTGATTGTTCGATACTTGGCCTCCATGAGGCCGTTTGCCCAGAGCTTTGATATTTATT
TG
ACACAGATCCTACGAGTTCTTGGTGAAAATGCAATTGCTGTTCGAACAAAAGCCATGAAGTGTTTGTC
T
GAGGTTGTTGCTGTAGACCCCAGTATTCTAGCAAGGCTTGATATGCAACGAGGTGTTCATGGACGATTG
ATG
GATAATTCGACTAGTGTCCGAGAAGCAGCAGTAGAATTACTAGGTCGATTTGTCCTTTGTCGACCTC
AG
CTTGCTGAACAGTATTATGATATGCTGATTGAAAGAATATTGGATACTGGTATCAGTGTCAGGAAAAG
A
GTAATAAAGATTCTCAGAGACATTTGTATTGAACAACCAACATTTCCAAAAATCACAGAAATGTGTGTA
AAA
ATGATTCGCAGAGTCAATGATGAAGAGGGCATTAAGAAATTAGTAAATGAAACATTCCAGAAACTCT
GG
TTTACTCCAACTCCACACAATGACAAAGAAGCAATGACAAGGAAAATTTTAAACATTACCGATGTGGT
T
GCAGCATGCAGAGATACTGGATATGACTGGTTTGAGCAACTGCTTCAAAACTTGTTGAAGTCCGAAGAG
GAT
TCCTCATATAAACCTGTGAAGAAAGCTTGTACTCAACTTGTTGATAACCTAGTTGAGCACATTCTTA
AA
TATGAGGAATCTCTAGCTGACTCTGACAATAAAGGTGTGAATTCTGGAAGATTGGTAGCTTGCATAAC
C
ACTTTGTTCTTATTCAGCAAAATAAGACCCCAGCTCATGGTTAAACATGCAATGACTATGCAACCATAC
CTT
ACCACTAAATGTAGTACGCAAAATGATTTCATGGTTATCTGCAATGTTGCAAAAATCCTAGAGCTAG
TT
GTACCACTGATGGAGCATCCAAGTGAAACTTTTCTTGCCACTATTGAGGAAGATCTAATGAAGCTCAT
C
ATCAAATATGGCATGACTGTAGTGCAACATTGTGTGAGCTGTCTTGGAGCTGTTGTAAATAAAGTGACA
CAA
AATTTTAAATTTGTGTGGGCTTGTTTCAATAGATACTATGGTGCCATTTCAAAATTAAAAAGTCAAC
AC
CAAGAGGACCCAAATAACACTTCACTTCTAACAAACAAACCAGCACTTCTTAGATCCCTTTTCACCGT
T
GGAGCACTATGTCGGCATTTTGATTTTGATCTGGAAGATTTTAAAGGCAACAGCAAGGTTAACATAAAA
GAT
AAAGTACTTGAACTATTGATGTATTTTACAAAACACTCAGATGAAGAAGTACAAACAAAAGCTATCA
TT
GGTCTAGGATTTGCCTTTATTCAGCATCCAAGTCTAATGTTCGAGCAAGAAGTGAAGAATCTATATAA
T
AATATTTTATCTGATAAGAACTCCTCAGTCAATTTAAAAATACAAGTGTTAAAAAACCTCCAGACCTAC
CTA
CAAGAAGAAGATACACGTATGCAGCAGGCAGATAGAGACTGGAAGAAAGTTGCAAAACAGGAAGACT
TA
AAAGAAATGGGTGATGTTTCCTCAGGGATGAGTAGTTCCATCATGCAGCTTTATCTCAAACAGGTGCT
T
GAGGCATTTTTTCACACCCAGTCAAGTGTACGCCACTTTGCCCTAAATGTCATTGCATTGACTCTAAAT
CAA
GGTCTTATTCATCCAGTTCAGTGTGTGCCATATTTAATTGCTATGGGCACAGACCCAGAACCTGCTA
TG
CGGAACAAGGCTGATCAGCAACTTGTGGAAATAGACAAAAAATATGCTGGATTCATTCATATGAAAGC
A
GTGGCTGGTATGAAGATGTCTTACCAGGTACAACAGGCAATCAACACATGCCTAAAAGATCCTGTAAGG
GGT
TTCAGACAAGACGAGTCCTCTAGCGCTTTGTGTTCACACCTTTACTCCATGATCCGTGGAAACCGCC
AA
CACAGACGAGCCTTTCTTATTTCTTTACTCAACCTCTTTGATGACACAGCAAAAACAGACGTGACTAT
G
CTCTTGTATATAGCAGACAATCTAGCCTGTTTTCCATACCAGACACAGGAAGAGCCGTTGTTTATAATG
CAT
CATATAGACATTACACTCTCAGTTTCTGGTAGTAACCTACTGCAGTCATTCAAGGAGTCTATGGTAA
AG
GACAAAAGGAAAGAGAGAAAATCATCACCTAGTAAGGAAAATGAGTCAAGCGACAGTGAAGAAGAAGT
T
TCCAGGCCTCGGAAGTCACGGAAACGTGTAGATTCAGATTCAGATTCAGATTCAGAAGACGATATAAAT
TCA
GTGATGAAATGTTTGCCAGAAAATTCAGCTCCTTTAATCGAATTTGCAAATGTGTCCCAGGGTATTT
TA
TTACTTCTCATGTTAAAACAACATTTGAAGAATCTTTGTGGATTTTCTGATAGTAAAATTCAGAAGTA
C
TCTCCATCTGAATCTGCAAAAGTATATGATAAAGCGATAAACCGAAAAACAGGAGTTCATTTTCATCCA
AAA
CAAACACTGGACTTCCTGCGGAGTGACATGGCTAATTCCAAAATCACAGAAGAGGTGAAAAGGAGTA
TA
GTAAAACAGTATCTAGATTTCAAACTTCTCATGGAACATCTGGACCCTGATGAAGAAGAAGAAGAAGG
G
GAGGTTTCAGCTAGCACAAATGCTCGGAACAAAGCAATTACCTCACTGCTTGGAGGAGGCAGCCCTAAA
AAT
AATACAGCAGCAGAGACAGAAGATGATGAAAGTGATGGGGAGGATAGAGGAGGAGGCACTTCAGGGT
CA
TTGAGAAGGTCAAAACGAAATTCAGACTCTACGGAGTTGGCAGCACAGATGAATGAAAGTGTTGACGT
C
ATGGATGTCATCGCTATTTGCTGTCCAAAGTACAAAGATCGACCACAAATTGCAAGAGTAGTGCAGAAA
ACC
AGCAGTGGCTTCAGTGTTCAGTGGATGGCAGGCTCCTACAGTGGCTCCTGGACTGAGGCTAAGCGCC
GT
GATGGCCGCAAACTGGTGCCTTGGGTAGACACTATTAAAGAGTCAGACATTATTTACAAAAAAATTGC
T
CTAACGAGTGCTAATAAGCTGACTAATAAAGTTGTTCAGACTTTACGATCCCTGTATGCCGCCAAGGAT
GGG
ACTTCCAGCTAA


Translation (2804 aa):
MNGDMPHVPITTLAGIASLTDLLNQLPLPSPLPATTTKSLLFNARIAEEVNCLLACRDDNLVSQLVHSLN
Q
VSTDH
IELKDNLGSDDPEGDIPVLLQAVLARSPNVFREKSMQNRYVQSGMMMSQYKLSQNSMHSSPASS
N
YQQTTISHSPS
SRFVPPQTSSGNRFMPQQNSPVPSPYAPQSPAGYMPYSHPSSYTTHPQMQQASVSSPI
V
AGGLRNIHDNKVSGPLSGNSANHHADNPRHGSSEDYLHMVHRLSSD
DGDSSTMRNAASFPLRSPQPVCS
P
AGSEGTPK
GSRPPLILQSQSLPCSSPRDVPPDILLDSPERKQKKQKKMKLGKDEKEQSEKAAMYDIISS
P
SKDSTKLTLRLSRVRSSDMDQQEDMISGVENSNVSENDIPFNVQYPGQTSKTPITPQDINRPLNAAQCL
S
QQEQTAFLPANQVPVLQQNTSVAAKQPQTSVVQNQQQISQQGPIYDEVELDALAEIERIERESAIERER
F
SKEVQDK
DKPLKKRKQDSYPQEAGGATGGNRPASQETGSTGNGSRPALMVSIDLHQAGRVDSQASITQD
S
DSIKKPEEIKQCNDAPVSVLQEDIVGSLKSTPENHPETPKKKSDPELSKSEMKQSESRLAESKPNENRL
V
ETKSSENKLETKVETQTEELKQNESRTTECKQNESTIVEPKQNENRLSDTKPNDNKQNNGRSETTKSRP
E
TPKQKGESRPETPKQKSDGHPETPKQKGDGRPETPKQKGESRPETPKQKNEGRPETPKHRHDNRRDSGK
P
STEKKPEVSKHKQDTKSDSPRLKSERAEALKQRPDGRSVSESLRRDHDNKQKSDDRGESERHRGDQSRV
R
RPETLRSSSRNEHGIKSDSSKTDKLERKHRHESGDSRERPSSGEQKSRPDSPRVKQGDSNKSRSDKLGF
K
SPTSKDDKRTEGNKSKVDTNKAHPDNKAEFPSYLLGGRSGALKNFVIPKIKRDKDGNVTQETKKMEMKG
E
PKDKVEKIGLVEDLNKGAKPVVVLQKLSLDDVQKLIKDREDKSRSSLKPIKNKPSKSNK
GSIDQSVLKE
L
PPELLAEIESTMPLCERVKMNKRKRSTVNEKPKYAEISSDEDNDSDEAFE
SSRKRHKKDDDKAWEYEER
D
RRSSGDHRRSGHSHEGRRSSGGGRYRNRSPSDSDMEDYSPPPSLSE
VARKMKKKEKQKKRKAYEPKLTP
E
EMMDSSTFKRFTASIENILDNLEDMDFTAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTD
K
TVKVLNILEKNIQDGSKLSTLLNH
NNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIE
D
VIERVIQYTKFHLQNTLYPQYDPVYRLDPHG
GGLLSSKAKRAKCSTHKQRVIVMLYNKVCDIVSSLSEL
L
EIQLLTDTTILQ
VSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSL
R
NF
RLNSSDMDGEPMYIQMVTALVLQLIQCVVHLPSSEKDSNAEEDSNKKIDQDVVITNSYETAMRTAQN
F
LSIFLK
KCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASL
D
YLGTVAARLRKDAVTSKMDQGSIERILKQ
VSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQW
F
RDTTLETEKAMKSQKDEESSEGTHHAKEIETTGQIMHRAENRKKFLRSIIKTTPSQFSTL
KMNSDTVDY
D
DACLIVRYLASMRPFAQSFDIYLTQ
ILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRL
M
DNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERIL
DTGISVRKRVIKILRDICIEQPTFPKITEMCV
K
MIRRVNDEEGIK
KLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEE
D
SSYKPVKKACTQLVDNLVEHILKYEESLA
DSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPY
L
TTKCS
TQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVT
Q
NFKFVWACFNRYY
GAISKLKSQHQEDPNNTSLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIK
D
KVLELLMYFTKHSDEEVQTKAIIGL
GFAFIQHPSLMFEQEVKNLYNNILSDKNSSVNLKIQVLKNLQTY
L
QEEDTRMQQADRD
WKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLN
Q
GLIHPVQ
CVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQAINTCLKDPVR
G
FRQDESSSALCSHLYSMIRGNRQHRRAFLISLLNLFDDTA
KTDVTMLLYIADNLACFPYQTQEEPLFIM
H
HIDITLSVSGSNLLQSFKE
SMVKDKRKERKSSPSKENESSDSEEEVSRPRKSRKRVDSDSDSDSEDDIN
S
VMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSD
SKIQKYSPSESAKVYDKAINRKTGVHFHP
K
QTLDFLRSDMANSKITEEVKRSIVKQYLD
FKLLMEHLDPDEEEEEGEVSASTNARNKAITSLLGGGSPK
N
NTAAETEDDESDGEDRGGGTSG
SLRRSKRNSDSTELAAQMNESVDVMDVIAICCPKYKDRPQIARVVQK
T
SSGFSVQWMAGSYSGSWTEAKRRDGRKLVPWVDTIKESDIIYKKIALTSANKLTNKVVQTLRSLYAAKD
G
TSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser