NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3198.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3198.1 Public Homo sapiens 3 BCHE 20 108 85 CCDS HistoryNCBI Gene:590Re-query CCDS DB by CCDS ID:3198.1Re-query CCDS DB by GeneID:590See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 3198.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000264381 ENSP00000264381 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264381Link to Ensembl Protein Viewer:ENSP00000264381Re-query CCDS DB by Nucleotide ID:ENST00000264381Re-query CCDS DB by Protein ID:ENSP00000264381
Original member Current member EBI,WTSI OTTHUMT00000350254 OTTHUMP00000212636 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000350254Link to Vega Protein Viewer:OTTHUMP00000212636Re-query CCDS DB by Nucleotide ID:OTTHUMT00000350254Re-query CCDS DB by Protein ID:OTTHUMP00000212636
Original member NCBI NM_000055.2 NP_000046.1 Updated not alive Link to Nucleotide Sequence:NM_000055.2Link to Protein Sequence:NP_000046.1Re-query CCDS DB by Nucleotide ID:NM_000055Re-query CCDS DB by Protein ID:NP_000046
Current member NCBI NM_000055.3 NP_000046.1 Accepted alive Link to Nucleotide Sequence:NM_000055.3Link to Protein Sequence:NP_000046.1Re-query CCDS DB by Nucleotide ID:NM_000055Re-query CCDS DB by Protein ID:NP_000046Link to BLAST:NP_000046.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000046.1 602 P06276 602 100% 0 0

Chromosomal Locations for CCDS 3198.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 165773382 165773506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 165786145 165786311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 165829517 165831033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1809 nt):
ATGCATAGCAAAGTCACAATCATATGCATCAGATTTCTCTTTTGGTTTCTTTTGCTCTGCATGCTTATTG
GG
AAGTCACATACTGAAGATGACATCATAATTGCAACAAAGAATGGAAAAGTCAGAGGGATGAACTTGAC
A
GTTTTTGGTGGCACGGTAACAGCCTTTCTTGGAATTCCCTATGCACAGCCACCTCTTGGTAGACTTCGA
TTC
AAAAAGCCACAGTCTCTGACCAAGTGGTCTGATATTTGGAATGCCACAAAATATGCAAATTCTTGCT
GT
CAGAACATAGATCAAAGTTTTCCAGGCTTCCATGGATCAGAGATGTGGAACCCAAACACTGACCTCAG
T
GAAGACTGTTTATATCTAAATGTATGGATTCCAGCACCTAAACCAAAAAATGCCACTGTATTGATATGG
ATT
TATGGTGGTGGTTTTCAAACTGGAACATCATCTTTACATGTTTATGATGGCAAGTTTCTGGCTCGGG
TT
GAAAGAGTTATTGTAGTGTCAATGAACTATAGGGTGGGTGCCCTAGGATTCTTAGCTTTGCCAGGAAA
T
CCTGAGGCTCCAGGGAACATGGGTTTATTTGATCAACAGTTGGCTCTTCAGTGGGTTCAAAAAAATATA
GCA
GCCTTTGGTGGAAATCCTAAAAGTGTAACTCTCTTTGGAGAAAGTGCAGGAGCAGCTTCAGTTAGCC
TG
CATTTGCTTTCTCCTGGAAGCCATTCATTGTTCACCAGAGCCATTCTGCAAAGTGGATCCTTTAATGC
T
CCTTGGGCGGTAACATCTCTTTATGAAGCTAGGAACAGAACGTTGAACTTAGCTAAATTGACTGGTTGC
TCT
AGAGAGAATGAGACTGAAATAATCAAGTGTCTTAGAAATAAAGATCCCCAAGAAATTCTTCTGAATG
AA
GCATTTGTTGTCCCCTATGGGACTCCTTTGTCAGTAAACTTTGGTCCGACCGTGGATGGTGATTTTCT
C
ACTGACATGCCAGACATATTACTTGAACTTGGACAATTTAAAAAAACCCAGATTTTGGTGGGTGTTAAT
AAA
GATGAAGGGACAGCTTTTTTAGTCTATGGTGCTCCTGGCTTCAGCAAAGATAACAATAGTATCATAA
CT
AGAAAAGAATTTCAGGAAGGTTTAAAAATATTTTTTCCAGGAGTGAGTGAGTTTGGAAAGGAATCCAT
C
CTTTTTCATTACACAGACTGGGTAGATGATCAGAGACCTGAAAACTACCGTGAGGCCTTGGGTGATGTT
GTT
GGGGATTATAATTTCATATGCCCTGCCTTGGAGTTCACCAAGAAGTTCTCAGAATGGGGAAATAATG
CC
TTTTTCTACTATTTTGAACACCGATCCTCCAAACTTCCGTGGCCAGAATGGATGGGAGTGATGCATGG
C
TATGAAATTGAATTTGTCTTTGGTTTACCTCTGGAAAGAAGAGATAATTACACAAAAGCCGAGGAAATT
TTG
AGTAGATCCATAGTGAAACGGTGGGCAAATTTTGCAAAATATGGGAATCCAAATGAGACTCAGAACA
AT
AGCACAAGCTGGCCTGTCTTCAAAAGCACTGAACAAAAATATCTAACCTTGAATACAGAGTCAACAAG
A
ATAATGACGAAACTACGTGCTCAACAATGTCGATTCTGGACATCATTTTTTCCAAAAGTCTTGGAAATG
ACA
GGAAATATTGATGAAGCAGAATGGGAGTGGAAAGCAGGATTCCATCGCTGGAACAATTACATGATGG
AC
TGGAAAAATCAATTTAACGATTACACTAGCAAGAAAGAAAGTTGTGTGGGTCTCTAA


Translation (602 aa):
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLR
F
KKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIW
I
YGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNI
A
AFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC
S
RENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN
K
DEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
V
GDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEI
L
SRSIVKRWANFAKY
GNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEM
T
GNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser