NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10689.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10689.2 Public Homo sapiens 16 SRCAP 20 108 85 CCDS HistoryNCBI Gene:10847Re-query CCDS DB by CCDS ID:10689.2Re-query CCDS DB by GeneID:10847See the combined annotation on chromosome 16 in Sequence Viewer

Public Note for CCDS 10689.2
The coding region has been updated to add an additional internal exon and to extend the N-terminus to one that is more supported by available transcript and conservation data. The N-terminal extension adds a HSA domain (found in DNA binding proteins and often associated with helicases) to the DEXDc, HELICc and AT_hook domains that are also found in this protein, and this is consistent with the function of this protein as a DNA helicase.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 10689.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000262518 ENSP00000262518 Accepted alive Link to Ensembl Transcript Viewer:ENST00000262518Link to Ensembl Protein Viewer:ENSP00000262518Re-query CCDS DB by Nucleotide ID:ENST00000262518Re-query CCDS DB by Protein ID:ENSP00000262518
Original member Current member EBI,WTSI OTTHUMT00000255523 OTTHUMP00000163226 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000255523Link to Vega Protein Viewer:OTTHUMP00000163226Re-query CCDS DB by Nucleotide ID:OTTHUMT00000255523Re-query CCDS DB by Protein ID:OTTHUMP00000163226
Original member Current member NCBI NM_006662.2 NP_006653.2 Accepted alive Link to Nucleotide Sequence:NM_006662.2Link to Protein Sequence:NP_006653.2Re-query CCDS DB by Nucleotide ID:NM_006662Re-query CCDS DB by Protein ID:NP_006653Link to BLAST:NP_006653.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006653.2 3230 Q6ZRS2-1 3230 100% 0 0

Chromosomal Locations for CCDS 10689.2

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 30700825 30700878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30704064 30704315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30707183 30707368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30707572 30707712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30709513 30709735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30709851 30710128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30710754 30710847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30710999 30711088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30711571 30711744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30711835 30712157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30712262 30712439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30712679 30712815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30713208 30713377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30713519 30713711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30716066 30716202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30716293 30716479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30720162 30720331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30720713 30720978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30721189 30721476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30722122 30722286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30722563 30722748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30722963 30723229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30723584 30725082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30728966 30729231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30729370 30729572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30733280 30733449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30733602 30733798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30733894 30734008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30734496 30734615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30736200 30736394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30736541 30736624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 30737049 30739733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (9693 nt):
ATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGACGGCA
TG
ACAGGCAGCAATCCTGTGTCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTC
C
CCGCAGCACATAGCTCAAGATTCCTCACTGGATGGACCTCCAGGCCCCCCAGATGGTGCCACAGTGCCC
CTG
GAGGGGTTCAGCTTATCCCAGGCTGCTGACCTGGCTAACAAGGGCCCGAAGTGGGAGAAGAGCCATG
CC
GAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGAGCTGCGGAAGGAGGG
T
TTCTGGTCACTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTG
TGC
GAAGAGATGCAGTGGCTCTCTGCTGACTTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGA
AG
GTGGTGCGCATGGTGATCCGGCACCACGAGGAGCAGCGGCAGAAAGAGGAACGGGCCCGGAGGGAGGA
G
CAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGTCAGGCAGTTCTGGAGCAATGTGGAG
AAG
GTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCATTTGG
AC
TTCATTGTGGGGCAAACTGAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTC
C
AGCAAAGCAGGCTCTTCCCCTTGCCTCGGCTCTTCCTCAGCTGCCTCCAGTCCTCCACCCCCTGCTTCT
CGC
CTGGATGATGAAGATGGGGACTTTCAACCCCAAGAGGATGAGGAAGAGGATGATGAGGAAACGATTG
AA
GTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGAGCTGCTTCGCCGTGA
G
GGAGAATTGCCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCC
TCT
CAAACCCCCTCATCTCATGATAGTGACACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCC
CT
CAGGTGTTGGAGATAAAGCCCCCACCCTCTGCTGTCACACAGCGCAACAAACAGCCTTGGCATCCAGA
T
GAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGATGAAGAGGATACTATAGCAGCTGAG
GAA
CAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCTTTCCA
TG
GAGGAGCTATTGCAGCAGTATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGA
A
GATGAGGTTGATGCTAATAGCTCTGACTGTGAACCAGAGGGGCCCGTGGAAGCGGAAGAGCCTCCTCAG
GAG
GATAGTAGCAGTCAGTCAGACTCTGTGGAGGACCGGAGTGAGGATGAGGAAGATGAACATTCAGAGG
AG
GAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGAGGATGCCCAATCACA
G
AGCCAAGCAGATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAG
CAG
AGTGAGGCAGATGCAGGCAGTGGGCCTCCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAA
TT
ACTGACATTGCTGCAGCAGCTGAAAGTCTCCAGCCCAAGGGTTACACGCTGGCCACGACCCAGGTAAA
G
ACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCAGCACATTGGGCTAGACTGGCTGGTT
ACC
ATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCAGACCA
TC
TCTCTGCTTGCCCACTTGGCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAG
C
GTGATGTTGAACTGGGAGATGGAGTTGAAACGGTGGTGCCCCAGCTTTAAAATCCTCACTTACTATGGA
GCC
CAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTGGACCAAGCCCAATGCCTTTCATGTGTGTATCACAT
CT
TACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTATCTCATTCTGGATGA
G
GCGCAGAACATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGC
CTG
CTCCTGACAGGAACTCCCTTGCAGAACAGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGC
CC
CATGTCTTCCAGTCTCATCGCGAGTTCAAGGAGTGGTTCTCTAATCCCCTAACTGGCATGATTGAGGG
C
AGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGTTTTGAGGCCTTTTTTACTGCGCCGA
GTT
AAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTCCAAGC
GT
CAACGCTGTCTCTATGATGACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTT
C
ATGAGCGTCATCAACATTTTGATGCAGCTGAGAAAAGTTTGCAATCATCCAAATCTGTTCGACCCTCGA
CCG
GTTACCTCCCCTTTCATCACCCCAGGCATCTGCTTCAGCACCGCCTCTCTGGTGCTAAGGGCCACGG
AT
GTCCATCCCCTCCAGCGGATAGACATGGGTCGATTTGACCTTATTGGCCTGGAAGGTCGTGTCTCTCG
A
TATGAGGCAGACACATTTCTGCCCCGGCACCGCCTCTCTCGCCGGGTACTGTTAGAAGTGGCTACTGCT
CCT
GACCCCCCACCCCGGCCCAAGCCAGTCAAGATGAAGGTCAACAGGATGCTGCAGCCAGTACCTAAGC
AA
GAAGGCCGGACAGTGGTGGTGGTGAACAACCCACGGGCGCCCCTGGGCCCTGTCCCAGTTCGACCTCC
T
CCAGGTCCTGAGCTCTCAGCCCAGCCCACCCCTGGCCCAGTCCCCCAAGTGCTGCCAGCATCACTGATG
GTT
TCAGCCTCACCTGCCGGGCCCCCGCTTATTCCTGCATCTCGGCCTCCTGGCCCTGTCCTCTTGCCTC
CA
CTGCAGCCCAACAGTGGTTCTCTCCCCCAGGTGTTGCCATCCCCCCTGGGGGTCCTGAGTGGGACCTC
A
CGGCCTCCCACGCCAACCTTGTCCCTAAAGCCAACACCACCTGCCCCAGTTCGCCTGAGCCCAGCCCCA
CCT
CCAGGCTCCTCTAGCCTGTTGAAGCCCCTGACAGTGCCACCAGGCTACACCTTCCCTCCTGCTGCTG
CC
ACCACCACTTCTACCACCACGGCAACTGCTACCACCACAGCAGTGCCAGCTCCGACTCCTGCACCACA
G
CGCCTCATTCTATCTCCCGATATGCAGGCTCGCCTGCCCTCAGGCGAAGTGGTCAGCATCGGGCAGTTA
GCC
TCACTGGCACAACGTCCAGTGGCTAATGCAGGGGGAAGCAAACCTCTCACCTTCCAAATCCAGGGCA
AC
AAGCTGACTTTGACTGGTGCCCAGGTGCGCCAGCTTGCTGTGGGGCAGCCCCGCCCGCTGCAAAGGAA
T
GTGGTGCACCTCGTGTCAGCAGGGGGGCAGCACCATCTCATCAGCCAGCCTGCCCATGTGGCCCTCATC
CAG
GCCGTGGCCCCGACCCCTGGCCCTACCCCTGTCTCTGTGCTGCCTTCTTCGACCCCCAGCACCACCC
CT
GCCCCTACTGGCCTCAGCCTTCCGCTTGCTGCTAACCAGGTGCCACCAACCATGGTGAATAATACAGG
C
GTGGTGAAGATTGTAGTGAGACAAGCCCCTCGGGATGGACTGACTCCTGTTCCTCCATTGGCCCCAGCA
CCC
CGGCCTCCGAGCTCTGGGCTTCCAGCTGTGTTGAATCCACGCCCCACGTTAACCCCTGGCCGGCTAC
CC
ACACCTACTCTGGGTACTGCTCGAGCCCCCATGCCCACACCCACTCTGGTGAGGCCTCTTCTCAAGCT
G
GTCCACAGTCCTTCACCTGAAGTCAGTGCTTCAGCCCCCGGAGCTGCCCCCTTGACCATCTCTTCTCCT
CTC
CACGTGCCATCCTCCCTCCCTGGGCCAGCCTCTTCTCCAATGCCAATTCCCAACTCCTCTCCCCTTG
CT
AGTCCTGTGTCCTCTACAGTCTCAGTTCCATTGTCATCTTCACTCCCCATCTCTGTCCCCACCACACT
T
CCTGCCCCAGCCTCGGCTCCACTCACCATCCCCATCTCAGCCCCCTTGACTGTTTCTGCTTCGGGCCCA
GCT
CTGTTGACCAGTGTGACTCCACCATTGGCACCTGTTGTCCCAGCGGCTCCTGGACCTCCCTCCTTGG
CA
CCATCTGGTGCTTCCCCGTCAGCATCAGCCTTGACTCTAGGTTTGGCCACAGCTCCATCCCTGTCTTC
A
TCTCAGACACCTGGTCACCCTCTGTTGTTGGCTCCCACCTCTTCACATGTTCCAGGGTTGAACTCAACC
GTG
GCCCCAGCATGCTCACCTGTCCTGGTGCCAGCTTCGGCTCTGGCCAGTCCTTTTCCGTCAGCACCAA
AT
CCAGCTCCAGCTCAGGCTTCCCTTCTGGCTCCAGCATCTTCTGCATCTCAGGCTCTAGCCACCCCTCT
G
GCTCCTATGGCGGCTCCACAGACAGCAATTCTGGCTCCTTCTCCAGCTCCTCCTCTGGCTCCTCTTCCG
GTC
CTGGCACCATCGCCAGGTGCTGCTCCTGTCCTGGCTTCATCACAGACTCCGGTTCCAGTTATGGCTC
CA
TCGTCTACTCCAGGAACCTCTTTAGCCTCAGCTTCACCGGTACCAGCTCCAACCCCTGTGTTGGCTCC
A
TCATCAACTCAAACTATGCTACCAGCCCCGGTTCCGTCACCTCTCCCGAGCCCGGCTTCTACGCAGACA
CTG
GCCCTAGCCCCAGCTTTAGCACCCACTCTTGGAGGCTCATCTCCATCTCAGACACTCTCTTTGGGAA
CG
GGGAACCCCCAGGGACCCTTTCCAACTCAGACATTGTCATTAACTCCAGCATCATCCCTGGTACCAAC
T
CCAGCCCAGACACTGTCTTTGGCACCAGGACCACCACTGGGTCCAACTCAGACGCTGTCTCTGGCTCCA
GCA
CCCCCTCTGGCTCCAGCTTCTCCAGTGGGCCCAGCCCCAGCTCACACGCTGACTTTGGCTCCAGCAT
CG
TCATCTGCTTCACTCCTGGCCCCAGCTTCAGTGCAGACACTGACCTTGAGCCCTGCCCCAGTTCCTAC
C
CTGGGCCCGGCCGCAGCTCAGACCTTGGCGCTGGCCCCAGCCTCCACACAGTCCCCAGCTTCCCAGGCA
TCT
TCCCTTGTGGTTTCGGCATCTGGTGCCGCTCCCTTGCCTGTCACCATGGTATCCCGGCTGCCTGTTT
CC
AAGGATGAGCCTGACACACTGACATTGCGCTCTGGTCCCCCCAGCCCTCCCTCCACTGCTACCTCGTT
T
GGTGGCCCCCGGCCTCGACGCCAGCCCCCCCCACCACCTCGTTCCCCTTTTTATCTGGACTCCCTGGAG
GAA
AAGCGGAAGCGGCAGCGGTCTGAACGCCTGGAACGGATTTTCCAACTTAGTGAGGCTCATGGGGCCC
TG
GCACCTGTGTATGGGACTGAAGTCCTGGATTTCTGTACCCTGCCCCAACCTGTTGCCAGCCCCATCGG
C
CCTCGTTCTCCTGGCCCCAGCCACCCCACCTTTTGGACTTATACCGAGGCTGCCCACCGGGCTGTACTG
TTT
CCCCAGCAGCGACTAGACCAGCTGTCAGAAATCATTGAGAGGTTCATCTTTGTCATGCCTCCTGTGG
AG
GCACCTCCCCCTTCCCTGCATGCCTGCCACCCACCTCCTTGGCTGGCCCCACGTCAGGCAGCCTTCCA
G
GAGCAATTGGCCTCTGAGCTCTGGCCCCGGGCTCGTCCTTTGCACCGTATTGTGTGTAACATGCGCACC
CAG
TTCCCTGACTTAAGACTCATCCAGTATGATTGCGGAAAGTTGCAGACGTTGGCAGTGCTGTTGCGGC
AG
CTCAAGGCAGAGGGCCACCGAGTGCTCATCTTCACCCAGATGACCCGAATGCTGGATGTATTGGAGCA
G
TTTCTCACCTACCATGGCCATCTCTACCTGCGCCTGGATGGATCTACTAGAGTTGAACAGAGACAGGCC
TTG
ATGGAACGGTTCAATGCAGACAAACGCATATTCTGCTTCATCCTTTCAACTCGGAGTGGGGGTGTGG
GC
GTGAACCTGACAGGAGCAGACACTGTTGTTTTTTATGACAGCGACTGGAATCCCACCATGGATGCTCA
G
GCCCAGGACCGCTGTCACCGAATTGGCCAGACCCGGGATGTCCACATATATAGGCTTATCAGTGAACGG
ACA
GTGGAGGAGAACATCCTAAAAAAGGCAAATCAGAAGAGAATGTTGGGGGACATGGCCATTGAGGGAG
GC
AACTTCACCACAGCCTATTTCAAACAGCAGACCATCCGAGAGCTGTTTGATATGCCCCTGGAGGAACC
T
TCTAGCTCATCCGTGCCCTCTGCCCCTGAAGAGGAGGAAGAGACTGTGGCCAGCAAGCAGACTCATATT
CTG
GAGCAGGCATTGTGTCGGGCAGAAGATGAAGAGGATATCCGTGCAGCCACCCAGGCCAAGGCTGAAC
AG
GTGGCTGAGCTTGCAGAATTTAATGAGAACGATGGGTTTCCTGCTGGTGAGGGAGAGGAAGCTGGCCG
G
CCTGGGGCTGAGGATGAGGAGATGTCCCGGGCTGAGCAGGAAATTGCTGCCCTCGTAGAACAGCTGACC
CCC
ATTGAGCGCTATGCCATGAAATTCCTGGAGGCCTCACTGGAGGAGGTGAGCCGAGAGGAGCTCAAAC
AG
GCAGAAGAGCAAGTGGAAGCTGCCCGCAAAGACCTGGACCAAGCCAAGGAGGAGGTGTTCCGCCTACC
C
CAAGAGGAGGAGGAGGGGCCGGGGGCTGGGGATGAGAGTTCCTGTGGGACTGGTGGAGGCACCCACCGG
CGC
AGTAAAAAGGCCAAAGCCCCTGAGAGGCCGGGGACTCGTGTCAGTGAGCGTCTTCGTGGAGCCCGGG
CT
GAGACTCAAGGGGCAAACCACACTCCTGTCATATCCGCCCATCAAACTCGCAGCACCACCACACCACC
C
CGCTGCAGTCCTGCCAGGGAGCGAGTTCCCAGGCCAGCACCTAGGCCTCGACCCACTCCAGCTTCAGCT
CCG
GCTGCAATTCCTGCCCTTGTTCCTGTCCCAGTTTCTGCCCCAGTACCCATTTCAGCCCCAAATCCAA
TA
ACCATTCTCCCTGTCCATATCTTGCCTTCTCCTCCCCCTCCTTCACAGATTCCTCCTTGTTCTTCTCC
T
GCCTGCACCCCTCCTCCTGCCTGTACCCCTCCACCAGCTCATACACCGCCTCCAGCCCAAACCTGTCTT
GTA
ACTCCTTCCTCTCCTCTCTTGCTTGGTCCACCTTCTGTGCCCATCTCTGCCTCAGTCACTAATCTCC
CC
TTGGGCTTGAGGCCTGAGGCAGAGCTGTGTGCCCAGGCATTGGCATCTCCAGAGTCCCTGGAGCTGGC
T
TCTGTGGCCAGTTCAGAAACCTCCTCACTTTCTCTTGTGCCCCCTAAAGATCTGTTGCCAGTTGCTGTG
GAG
ATCCTGCCTGTGTCAGAGAAGAACCTTTCTCTCACCCCTTCTGCACCCAGCCTGACCTTGGAGGCTG
GC
AGCATCCCCAATGGTCAAGAGCAGGAGGCACCAGATTCTGCTGAGGGGACCACCCTTACAGTGCTGCC
T
GAAGGTGAGGAGTTGCCCCTGTGTGTGAGTGAGAGCAATGGCCTGGAGCTCCCACCCTCAGCAGCATCT
GAT
GAGCCACTTCAGGAGCCACTGGAGGCTGACAGGACCTCGGAAGAGCTGACAGAGGCCAAGACCCCAA
CC
TCCAGCCCAGAGAAGCCACAGGAACTCGTTACAGCTGAGGTTGCAGCTCCATCCACCTCATCTTCAGC
C
ACTTCCTCGCCTGAGGGTCCTTCACCTGCCCGACCTCCTCGGCGTCGCACCAGTGCTGATGTGGAAATT
AGG
GGTCAAGGGACTGGTCGGCCAGGACAACCACCAGGCCCCAAAGTGCTTCGAAAGCTGCCAGGACGGC
TG
GTAACTGTGGTAGAGGAAAAGGAACTGGTGCGGCGGCGGCGGCAGCAGCGGGGAGCTGCCAGCACCCT
A
GTGCCTGGGGTCTCTGAGACTAGTGCCAGCCCGGGAAGCCCGTCTGTCCGCAGCATGTCAGGGCCAGAA
TCC
TCCCCTCCCATTGGTGGGCCCTGTGAAGCTGCTCCTTCATCCTCACTGCCCACTCCACCCCAGCAGC
CC
TTCATTGCTCGCCGTCACATTGAGCTGGGGGTGACTGGTGGTGGCAGCCCCGAGAATGGAGACGGAGC
A
CTGCTCGCCATCACCCCACCTGCTGTGAAACGTCGGAGGGGGAGGCCCCCCAAGAAGAACAGGTCTCCA
GCA
GATGCTGGGAGAGGTGTGGATGAGGCACCCTCATCCACCTTGAAGGGAAAAACCAATGGGGCTGACC
CA
GTCCCTGGGCCTGAGACCCTAATTGTTGCAGATCCTGTCCTGGAACCACAGCTTATTCCTGGGCCCCA
G
CCTCTTGGACCCCAGCCAGTTCACAGACCCAATCCCCTCCTGTCACCTGTGGAGAAAAGAAGGCGAGGA
CGA
CCCCCTAAAGCACGAGATTTGCCCATCCCTGGGACCATTTCCTCTGCAGGGGATGGCAACTCCGAAA
GT
CGGACACAGCCACCCCCACACCCATCACCCCTAACCCCACTCCCACCACTGCTAGTTTGTCCCACTGC
T
ACTGTTGCCAACACTGTCACCACTGTCACCATTTCAACGTCCCCACCCAAACGGAAGAGGGGCCGACCT
CCC
AAGAATCCTCCATCACCTCGGCCCAGCCAGCTCCCCGTCTTGGACCGTGACAGCACTTCTGTTCTCG
AG
AGCTGTGGATTGGGGAGGCGACGGCAACCCCAGGGCCAAGGGGAGAGTGAGGGTAGTTCCTCTGATGA
G
GATGGAAGCCGCCCCCTCACCCGCCTGGCCCGCCTTCGGCTTGAAGCAGAAGGAATGCGAGGACGGAAG
AGT
GGAGGGTCCATGGTGGTGGCTGTAATTCAGGATGACCTGGACTTAGCAGATAGCGGGCCAGGCGGGT
TG
GAATTGACACCACCTGTGGTCTCACTAACCCCAAAACTGCGCTCGACCCGGCTGCGTCCAGGGTCTCT
A
GTCCCCCCACTAGAGACTGAGAAGTTGCCTCGCAAACGAGCAGGGGCCCCAGTTGGTGGGAGTCCTGGG
CTG
GCAAAGCGGGGCCGCCTACAGCCCCCAAGTCCCCTGGGGCCTGAGGGTTCAGTAGAGGAGTCTGAGG
CT
GAAGCCTCAGGTGAGGAGGAGGAAGGGGATGGGACCCCACGCCGACGTCCTGGCCCCCGCCGGCTTGT
T
GGGACCACCAACCAAGGGGACCAGCGCATCCTGCGCAGCAGCGCCCCTCCCTCCCTGGCTGGCCCTGCT
GTT
AGTCACAGAGGCCGCAAGGCCAAGACGTGA


Translation (3230 aa):
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVP
L
EGFSLSQAADLANKGPKWEKSHAEIAEQAKH
EAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYL
C
EEMQWLSADFAQERRWKRGVARK
VVRMVIRHHEEQRQKEERARREEQAKLRRIASTMAKDVRQFWSNVE
K
VVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPAS
R
LDDE
DGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSP
S
QTPSSHDSDTRDGPEEGAEEEPPQVLE
IKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAE
E
QLEGEVDHAMELSELARE
GELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQ
E
DSSSQS
DSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQADEEEEDDDFGVEYLLARDEE
Q
SEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQ
VKTPIPLLLRGQLREYQHIGLDWLV
T
MYEKKLNGILADEMGLGKTIQTISLLAHLACEK
GNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYG
A
QKERKLKRQ
GWTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRR
L
LLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHK
VLRPFLLRR
V
KVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQT
TTKETLATGHFMSVINILMQLRKVCNHPNLFDPR
P
VTSPFITPGICFSTASLVLRATDVHPLQ
RIDMGRFDLIGLEGRVSRYEADTFLPRHRLSRRVLLEVATA
P
DPPPRPKPVKMKVN
RMLQPVPKQEGRTVVVVNNPRAPLGPVPVRPPPGPELSAQPTPGPVPQVLPASLM
V
SASPAGPPLIPASRPPGPVLLPPLQPNSGSLPQ
VLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAP
P
PGSSSLLKPLTVPPGYTFPPAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLP
SGEVVSIGQL
A
SLAQRPVANAGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQ
RNVVHLVSAGGQHHLISQPAHVALI
Q
AVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQ
VPPTMVNNTGVVKIVVRQAPRDGLTPVPPLAPA
P
RPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVS
ASAPGAAPLTISSP
L
HVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGP
A
LLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNST
V
APACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLP
V
LAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT
L
ALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAP
A
PPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQA
S
SLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATSFGGPRPRRQPPPPPRSPFYL
DSLE
E
KRKRQRSERLERIFQLSEAHGALAPVYGTEVLDFCTLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVL
F
PQQRLDQLSEIIE
RFIFVMPPVEAPPPSLHACHPPPWLAPRQAAFQEQLASELWPRARPLHRIVCNMRT
Q
FPDLRLIQYDC
GKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQA
L
MERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIY
RLISER
T
VEENILKKANQKRMLGDMAIEGGNFTTAYFKQ
QTIRELFDMPLEEPSSSSVPSAPEEEEETVASKQTHI
L
EQ
ALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAGRPGAEDEEMSRAEQEIAALVEQLT
P
IERYAMKFLEASLEEVSREELKQAE
EQVEAARKDLDQAKEEVFRLPQEEEEGPGAGDESSCGTGGGTHR
R
SKKAKAPERPGTRVSERLRGARAETQGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASA
P
AAIPALVPVPVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPPAQTCL
V
TPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLVPPKDLLPVAV
E
ILPVSEKNLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGEELPLCVSESNGLELPPSAAS
D
EPLQEPLEADRTSEELTEAKTPTSSPEKPQELVTAEVAAPSTSSSATSSPEGPSPARPPRRRTSADVEI
R
GQGTGRPGQPPGPKVLRKLPGRLVTVVEEKELVRRRRQQRGAASTLVPGVSETSASPGSPSVRSMSGPE
S
SPPIGGPCEAAPSSSLPTPPQQPFIARRHIELGVTGGGSPENGDGALLAITPPAVKRRRGRPPKKNRSP
A
DAGRGVDEAPSSTLKGKTNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEKRRRG
R
PPKARDLPIPGTISSAGDGNSESRTQPPPHPSPLTPLPPLLVCPTATVANTVTTVTISTSPPKRKRGRP
P
KNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGSRPLTRLARLRLEAEGMRGRK
S
GGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPKLRSTRLRPGSLVPPLETEKLPRKRAGAPVGGSPG
L
AKRGRLQPPSPLGPEGSVEESEAEASGEEEEGDGTPRRRPGPRRLVGTTNQGDQRILRSSAPPSLAGPA
V
SHRGRKAKT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser