NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32203.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32203.1 Public Homo sapiens 15 PLA2G4D 20 108 85 CCDS HistoryNCBI Gene:283748Re-query CCDS DB by CCDS ID:32203.1Re-query CCDS DB by GeneID:283748See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32203.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000290472 ENSP00000290472 Accepted alive Link to Ensembl Transcript Viewer:ENST00000290472Link to Ensembl Protein Viewer:ENSP00000290472Re-query CCDS DB by Nucleotide ID:ENST00000290472Re-query CCDS DB by Protein ID:ENSP00000290472
Original member Current member EBI,WTSI OTTHUMT00000419317 OTTHUMP00000248794 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000419317Link to Vega Protein Viewer:OTTHUMP00000248794Re-query CCDS DB by Nucleotide ID:OTTHUMT00000419317Re-query CCDS DB by Protein ID:OTTHUMP00000248794
Original member Current member NCBI NM_178034.3 NP_828848.3 Accepted alive Link to Nucleotide Sequence:NM_178034.3Link to Protein Sequence:NP_828848.3Re-query CCDS DB by Nucleotide ID:NM_178034Re-query CCDS DB by Protein ID:NP_828848Link to BLAST:NP_828848.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_828848.3 818 Q86XP0-1 818 100% 0 0

Chromosomal Locations for CCDS 32203.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 42068715 42068941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42069909 42070095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42070717 42070883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42071123 42071317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42071444 42071551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42071774 42071911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42072275 42072392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42079537 42079759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42080997 42081133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42081479 42081614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42081797 42081834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42082279 42082389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42083198 42083334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42083716 42083779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42085096 42085138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42085491 42085531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42086213 42086344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42087300 42087436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42087628 42087700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 42094415 42094459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2457 nt):
ATGGAGAGCCTGTCACCTGGGGGACCACCTGGCCACCCTTACCAGGGGGAGGCCTCTACCTGCTGGCAGC
TC
ACAGTGAGGGTCCTGGAGGCGCGGAACCTGCGCTGGGCTGACCTGTTGAGTGAGGCCGACCCTTACGT
G
ATCCTACAGCTGTCGACCGCACCTGGAATGAAGTTTAAGACCAAGACGCTCACCGACACCAGTCATCCT
GTG
TGGAATGAGGCCTTCCGTTTCCTTATCCAAAGTCAGGTCAAGAATGTTCTGGAGCTTAGCATCTATG
AT
GAGGACTCAGTCACGGAGGATGACATCTGCTTCAAGGTTCTCTATGACATCTCAGAAGTCCTCCCTGG
C
AAGCTGCTCCGGAAAACCTTCTCCCAGAGTCCCCAGGGAGAGGAGGAGCTGGATGTGGAGTTCCTGATG
GAA
GAAACGTCAGATCGCCCAGAAAACCTCATCACCAACAAAGTCATTGTGGCCCGAGAGCTGTCATGCC
TG
GATGTGCATCTGGACAGCACAGGGAGCACCGCTGTGGTTGCAGATCAGGACAAGCTGGAGCTGGAGCT
G
GTGCTGAAGGGGTCCTATGAGGACACACAGACATCCTTCCTGGGCACAGCCTCTGCCTTCCGCTTCCAC
TAC
ATGGCAGCCCTAGAGACAGAGCTGAGCGGGCGCCTGAGGAGCTCCAGAAGCAATGGCTGGAATGGGG
AC
AACTCAGCTGGGTACCTCACTGTGCCCCTGAGGCCCTTGACCATTGGGAAGGAGGTGACTATGGATGT
T
CCTGCTCCAAATGCCCCAGGAGTGAGGCTGCAGCTCAAGGCAGAGGGCTGCCCTGAGGAGCTGGCCGTG
CAC
CTGGGCTTCAATCTCTGTGCAGAGGAGCAGGCCTTCCTGAGCAGGAGGAAGCAGGTGGTGGCCAAGG
CC
CTGAAGCAGGCCCTGCAGCTGGACAGAGACCTGCAGGAGGATGAGGTACCCGTTGTGGGCATCATGGC
C
ACAGGAGGAGGTGCCCGGGCCATGACCTCACTCTACGGCCACCTATTGGCCTTGCAGAAGCTGGGCCTC
CTA
GACTGTGTGACCTACTTCAGTGGCATCTCTGGCTCTACGTGGACAATGGCCCACCTGTACGGGGACC
CT
GAGTGGTCGCAGAGGGACCTGGAGGGACCTATCAGATACGCCCGGGAGCACCTGGCCAAGAGCAAGCT
G
GAGGTCTTTTCCCCAGAGCGCCTGGCGAGCTACCGCCGGGAGCTGGAGCTGCGGGCTGAGCAGGGCCAC
CCC
ACGACCTTTGTGGACCTGTGGGCGCTAGTGCTGGAGTCCATGCTGCACGGCCAGGTGATGGATCAGA
AG
CTGTCAGGACAGAGAGCCGCCCTGGAACGGGGTCAGAACCCTCTGCCCCTCTACTTGAGCCTCAATGT
C
AAAGAGAACAATCTGGAGACACTGGACTTCAAGGAGTGGGTTGAGTTCTCCCCCTATGAGGTCGGTTTC
CTG
AAGTACGGGGCCTTCGTCCCTCCTGAGCTCTTCGGCTCCGAGTTCTTCATGGGACGGCTGATGAGGA
GG
ATCCCGGAGCCCCGGATCTGCTTTCTGGAAGCCATCTGGAGCAACATTTTCTCCCTGAACCTGCTGGA
T
GCCTGGTATGACCTCACCAGTTCTGGGGAGTCCTGGAAACAGCACATCAAGGACAAGACCAGGAGCTTA
G
AG
AAGGAGCCCCTGACCACCTCGGGGACCTCCTCGCGGCTGGAGGCCTCGTGGCTGCAGCCAGGCACGG
CG
CTGGCCCAGGCATTTAAAGGCTTCCTGACAGGCAGGCCCCTCCACCAGCGCAGCCCCAACTTCCTCCA
G
GGCCTCCAGCTGCACCAGGACTACTGTAGCCACAAAGACTTCTCCACCTGGGCAGACTACCAGCTTGAC
TCC
ATGCCCAGCCAGCTGACCCCCAAGGAGCCCCGGCTCTGCCTGGTGGACGCCGCCTACTTCATCAACA
CC
AGCTCTCCCTCCATGTTCCGGCCAGGCCGCAGGCTGGACCTCATCCTCTCCTTCGACTACTCCCTATC
T
GCGCCCTTCGAGGCACTGCAGCAGACGGAGCTGTACTGCCGGGCCCGGGGGCTGCCCTTCCCCCGGGTG
GAA
CCCAGCCCTCAGGACCAGCACCAGCCAAGGGAATGCCACCTCTTCTCAGACCCCGCCTGCCCCGAGG
CC
CCGATCCTGCTGCACTTCCCGCTGGTCAATGCCTCCTTCAAGGACCACTCAGCCCCCGGTGTCCAGCG
C
AGCCCCGCAGAGCTCCAGGGTGGCCAAGTGGATCTCACCGGGGCCACCTGCCCCTACACCCTGTCCAAC
ATG
ACCTACAAGGAGGAAGACTTCGAGCGCCTGCTGCGGCTCAGTGACTACAACGTGCAGACCAGCCAGG
GT
GCCATCCTGCAGGCCCTGAGGACCGCGCTGAAGCACCGGACTCTAGAGGCGAGGCCTCCAAGGGCACA
G
ACCTGA


Translation (818 aa):
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHP
V
WNEAFRFLIQSQVK
NVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLM
E
E
TSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFH
Y
MAALETELSGRLR
SSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAV
H
LGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDE
VPVVGIMATGGGARAMTSLYGHLLALQKLGL
L
DCVTYFSGISGST
WTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
P
TTFVDLWALVLESMLHGQ
VMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEVGF
L
KYGAFVPPELFGSEFFMGRLMRRIPEPRICFLE
AIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSL
E
KEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLD
S
MPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFE
ALQQTELYCRARGLPFPRV
E
PSPQDQHQPRECHLFSDPACPEAPILLHFPLVNASFKDHSAP
GVQRSPAELQGGQVDLTGATCPYTLSN
M
TYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser