NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23886.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23886.1 Public Mus musculus 10 2010107G23Rik 21 106 86 CCDS HistoryNCBI Gene:69894Re-query CCDS DB by CCDS ID:23886.1Re-query CCDS DB by GeneID:69894See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 23886.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000064050 ENSMUSP00000063504 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064050Link to Ensembl Protein Viewer:ENSMUSP00000063504Re-query CCDS DB by Nucleotide ID:ENSMUST00000064050Re-query CCDS DB by Protein ID:ENSMUSP00000063504
Original member Current member EBI,WTSI ENSMUST00000125704 ENSMUSP00000115865 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000125704Link to Ensembl Protein Viewer:ENSMUSP00000115865Re-query CCDS DB by Nucleotide ID:ENSMUST00000125704Re-query CCDS DB by Protein ID:ENSMUSP00000115865
Original member Current member EBI,WTSI ENSMUST00000142796 ENSMUSP00000116424 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142796Link to Ensembl Protein Viewer:ENSMUSP00000116424Re-query CCDS DB by Nucleotide ID:ENSMUST00000142796Re-query CCDS DB by Protein ID:ENSMUSP00000116424
Original member Current member EBI,WTSI ENSMUST00000124615 ENSMUSP00000118912 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000124615Link to Ensembl Protein Viewer:ENSMUSP00000118912Re-query CCDS DB by Nucleotide ID:ENSMUST00000124615Re-query CCDS DB by Protein ID:ENSMUSP00000118912
Original member Current member EBI,WTSI ENSMUST00000142821 ENSMUSP00000119289 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142821Link to Ensembl Protein Viewer:ENSMUSP00000119289Re-query CCDS DB by Nucleotide ID:ENSMUST00000142821Re-query CCDS DB by Protein ID:ENSMUSP00000119289
Original member Current member EBI,WTSI OTTMUST00000081471 OTTMUSP00000043599 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081471Link to Vega Protein Viewer:OTTMUSP00000043599Re-query CCDS DB by Nucleotide ID:OTTMUST00000081471Re-query CCDS DB by Protein ID:OTTMUSP00000043599
Original member Current member EBI,WTSI OTTMUST00000081472 OTTMUSP00000043600 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081472Link to Vega Protein Viewer:OTTMUSP00000043600Re-query CCDS DB by Nucleotide ID:OTTMUST00000081472Re-query CCDS DB by Protein ID:OTTMUSP00000043600
Original member Current member EBI,WTSI OTTMUST00000081473 OTTMUSP00000043601 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081473Link to Vega Protein Viewer:OTTMUSP00000043601Re-query CCDS DB by Nucleotide ID:OTTMUST00000081473Re-query CCDS DB by Protein ID:OTTMUSP00000043601
Original member Current member EBI,WTSI OTTMUST00000081474 OTTMUSP00000043602 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081474Link to Vega Protein Viewer:OTTMUSP00000043602Re-query CCDS DB by Nucleotide ID:OTTMUST00000081474Re-query CCDS DB by Protein ID:OTTMUSP00000043602
Original member Current member NCBI NM_027251.3 NP_081527.1 Accepted alive Link to Nucleotide Sequence:NM_027251.3Link to Protein Sequence:NP_081527.1Re-query CCDS DB by Nucleotide ID:NM_027251Re-query CCDS DB by Protein ID:NP_081527Link to BLink:NP_081527.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081527.1 120 Q9D882 120 100% 0 0

Chromosomal Locations for CCDS 23886.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 62108854 62109123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 62109884 62109976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (363 nt):
ATGGTGAGGATCTTGGCCAATGGGGAGATCGTTCAGGATGATGACCCACGAGTGAGGACGACCACCCAGC
AC
AGAAGTAGCAGCTCTCAGCAGGGCTTTTTCAACAGAGGCCACGGCGCACCTCCAGGGGGCCCTGGACC
C
CGCCAGCAGCAGGCAGGTGCCCGACTGGGTGCTGCCCAATCTCCTTTCAGTGACCTGAACCGGCAGCTG
GTG
AACATGGGCTTCCCACAATGGCACCTTGGGAACCACGTGGTGGAACCTGTGACCTCCATCCTCCTGC
TC
TTCCTGCTTATGATGCTCGGGGTTCGTGGCCTCCTGCTTGTGGGCCTGGTCTACCTGGTGTCTCACCT
G
AGTCAGCGGTGA


Translation (120 aa):
MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFSDLNRQL
V
NMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser