NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29714.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29714.1 Public Mus musculus 19 Pgm5 21 106 86 CCDS HistoryNCBI Gene:226041Re-query CCDS DB by CCDS ID:29714.1Re-query CCDS DB by GeneID:226041See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29714.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047666 ENSMUSP00000036025 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047666Link to Ensembl Protein Viewer:ENSMUSP00000036025Re-query CCDS DB by Nucleotide ID:ENSMUST00000047666Re-query CCDS DB by Protein ID:ENSMUSP00000036025
Original member Current member EBI,WTSI OTTMUST00000070197 OTTMUSP00000035745 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070197Link to Vega Protein Viewer:OTTMUSP00000035745Re-query CCDS DB by Nucleotide ID:OTTMUST00000070197Re-query CCDS DB by Protein ID:OTTMUSP00000035745
Original member Current member NCBI NM_175013.2 NP_778178.3 Accepted alive Link to Nucleotide Sequence:NM_175013.2Link to Protein Sequence:NP_778178.3Re-query CCDS DB by Nucleotide ID:NM_175013Re-query CCDS DB by Protein ID:NP_778178Link to BLink:NP_778178.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_778178.3 567 Q8BZF8 567 100% 0 0

Chromosomal Locations for CCDS 29714.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 24684485 24684574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24709228 24709362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24727669 24727852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24733542 24733677 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24750365 24750480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24815658 24815812 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24816411 24816601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24820120 24820245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24824292 24824438 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24834743 24834905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 24861529 24861789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1704 nt):
ATGGAGGGGAGCCCCATCCCAGTGCTGACGGTGCCCACGGCGCCCTATGAGGACCAGCGGCCGACCGGTG
GC
GGCGGGCTGCGACGGCCCACAGGGCTCTTCGAGGGCCAGCGCAACTACCTGCCCAACTTCATCCAGAG
T
GTGCTGTCGTCCATCGACCTGCGCGACCGTCAGGGTTGCACCATGGTGGTGGGCAGCGACGGCAGGTAC
TTC
AGCAGGACGGCTACTGAGATCGTGGTGCAGATGGCTGCGGCCAATGGGATTGGTCGACTGATTATTG
GG
CAGAATGGCATCTTGTCGACCCCTGCAGTCTCCTGCATTATCAGGAAGATCAAGGCAGCTGGTGGGAT
C
ATTCTAACAGCCAGCCACTGTCCTGGAGGACCAGGGGGAGAGTTTGGAGTGAAGTTTAATGTTGCCAAT
GGA
GGTCCTGCACCAGATGTTGTCTCAGACAAAATCTACCAGATCAGCAAAACAATTGAGGAATATGCCA
TA
TGTCCAGATCTTCGAATTGACCTATCTCGACTGGGAAGACAAGAATTTGACCTGGAGAACAAGTTCAA
A
CCATTCAGAGTGGAGATTGTGGACCCCGTTGACATCTATCTCAACCTCCTCCGGAATATCTTTGACTTT
AAC
GCCATCAAGAGTTTGCTGACAGGACCCAGCCAACTGAAGATCCGTGTTGATGCTATGCATGGAGTTA
TG
GGACCCTATGTAAGAAAAGTTCTGTGTGATGAACTGGGAGCTCCAGCCAACTCCGCAATAAACTGTGT
C
CCACTAGAAGACTTCGGAGGGCAGCACCCAGACCCAAACCTGACCTATGCAACCACCCTCCTGGAAGCC
ATG
AAGGGGGGAGAATATGGATTTGGAGCTGCGTTTGATGCTGATGGGGACCGTTATATGATCCTTGGCC
AA
AATGGCTTCTTTGTGAGTCCCTCAGACTCTCTCGCCATCATCGCTGCCAACCTCTCTTGCATTCCGTA
T
TTCCGTCAGATGGGGGTTCGCGGGTTTGGGAGGAGTATGCCAACCAGCACGGCTCTGGACAGAGTGGCT
AAA
TCAATGAAGGTCCCCGTGTATGAGACCCCTGCTGGATGGAGATTCTTCTCAAATCTGATGGACTCCG
GA
CGATGCTCTCTGTGTGGAGAGGAGAGCTTCGGCACTGGGTCTGATCACCTCCGAGAGAAAGATGGCCT
C
TGGGCTGTCTTGGTCTGGCTGTCCATTATTGCTGCCCGGAAGCAGAGCGTGGAGGAAATTGTTAGAGAC
CAT
TGGGCCAAATATGGCCGCCACTACTACTGCAGGTTTGATTACGAGGGACTGGAGCCCAAGGCAACCT
AT
TACATCATGAGGGATCTGGAGGCCCTAGTGACAGACAAGTCCTTCATCGGCCAGCAGTTTGCTGTAGG
G
AGCCACATTTACAGCATTGCAAAGACTGACAGCTTTGAATATGTGGACCCCGTGGATGGCACCGTGACC
AAG
AAACAGGGCCTGAGGATCATCTTCTCGGATGCATCACGGCTAATATTCCGGCTCAGTTCCTCCAGTG
GT
GTGCGGGCCACCATCAGACTGTATGCAGAGAGCTACGAGAGGGATCCCAGTGGTCACGACCAGGAACC
A
CAGGCAGTGCTGAGCCCGCTCATCGCCATCGCATTGAAAATATCTCAGATTCACGAGAGGACCGGCCGG
AGA
GGACCCACCGTCATCACCTGA


Translation (567 aa):
MEGSPIPVLTVPTAPYEDQRPTGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRY
F
SRTATEIVVQMAAANG
IGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGPGGEFGVKFNVAN
G
GPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDPVDIYLNLLRNIFDF
N
AIKSLLTGPSQLKIRVDAMHG
VMGPYVRKVLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEA
M
KGGEYGFGAAFDADG
DRYMILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSTALDRVA
K
SMKVPVYETPAGWRFFSNLMDSGRCSLCGEESFGT
GSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRD
H
WAKYGRHYYC
RFDYEGLEPKATYYIMRDLEALVTDKSFIGQQFAVGSHIYSIAKTDSFEYVDPVDGTVT
K
KQ
GLRIIFSDASRLIFRLSSSSGVRATIRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGR
R
GPTVIT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser