NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS47409.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47409.1 Public Homo sapiens 6 HLA-DRB1 15 105 74 CCDS HistoryNCBI Gene:3123Re-query CCDS DB by CCDS ID:47409.1Re-query CCDS DB by GeneID:3123

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Sequence IDs included in CCDS 47409.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000360004 ENSP00000353099 Accepted alive Link to Ensembl Transcript Viewer:ENST00000360004Link to Ensembl Protein Viewer:ENSP00000353099Re-query CCDS DB by Nucleotide ID:ENST00000360004Re-query CCDS DB by Protein ID:ENSP00000353099
Original member Current member EBI,WTSI OTTHUMT00000076393 OTTHUMP00000029282 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000076393Link to Vega Protein Viewer:OTTHUMP00000029282Re-query CCDS DB by Nucleotide ID:OTTHUMT00000076393Re-query CCDS DB by Protein ID:OTTHUMP00000029282
Original member Current member NCBI NM_002124.3 NP_002115.2 Accepted alive Link to Nucleotide Sequence:NM_002124.3Link to Protein Sequence:NP_002115.2Re-query CCDS DB by Nucleotide ID:NM_002124Re-query CCDS DB by Protein ID:NP_002115Link to BLink:NP_002115.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002115.2 266 P01911 266 100% 0 0

Chromosomal Locations for CCDS 47409.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 6 (NC_000006.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 32546868 32546881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32548024 32548047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32548523 32548633 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32549334 32549615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32551886 32552155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 32557420 32557519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (801 nt):
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGACAGCGCTGACAGTGACACTGATGGTGCTGAGCT
CC
CCACTGGCTTTGTCTGGGGACACCCGACCACGTTTCCTGTGGCAGCCTAAGAGGGAGTGTCATTTCTT
C
AATGGGACGGAGCGGGTGCGGTTCCTGGACAGATACTTCTATAACCAGGAGGAGTCCGTGCGCTTCGAC
AGC
GACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGACGCTGAGTACTGGAACAGCCAGA
AG
GACATCCTGGAGCAGGCGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGTGGAGAG
C
TTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTATATCCTTCAAAGACCCAGCCCCTGCAGCAC
CAC
AACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCTGAACG
GC
CAGGAAGAGAAGGCTGGGATGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCT
G
GTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGCGTGACA
AGC
CCTCTCACAGTGGAATGGAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GC
TTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTC
T
GGACTTCAGCCAACAGGATTCCTGAGCTGA


Translation (266 aa):
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFD
S
DVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR
VQPKVTVYPSKTQPLQH
H
NLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT
S
PLTVEW
RARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser