NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10472.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10472.1 Public Homo sapiens 16 PDPK1 15 105 74 CCDS HistoryNCBI Gene:5170Re-query CCDS DB by CCDS ID:10472.1Re-query CCDS DB by GeneID:5170

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10472.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000342085 ENSP00000344220 Accepted alive Link to Ensembl Transcript Viewer:ENST00000342085Link to Ensembl Protein Viewer:ENSP00000344220Re-query CCDS DB by Nucleotide ID:ENST00000342085Re-query CCDS DB by Protein ID:ENSP00000344220
Original member Current member EBI,WTSI OTTHUMT00000250831 OTTHUMP00000159109 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000250831Link to Vega Protein Viewer:OTTHUMP00000159109Re-query CCDS DB by Nucleotide ID:OTTHUMT00000250831Re-query CCDS DB by Protein ID:OTTHUMP00000159109
Original member Current member NCBI NM_002613.4 NP_002604.1 Accepted alive Link to Nucleotide Sequence:NM_002613.4Link to Protein Sequence:NP_002604.1Re-query CCDS DB by Nucleotide ID:NM_002613Re-query CCDS DB by Protein ID:NP_002604Link to BLAST:NP_002604.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002604.1 556 O15530-1 556 100% 0 0

Chromosomal Locations for CCDS 10472.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 16 (NC_000016.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 2588114 2588137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2607704 2607964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2611481 2611523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2611772 2611909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2615554 2615698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2616357 2616454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2627426 2627501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2631296 2631364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2631608 2631704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2633413 2633586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2636677 2636894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2645794 2645851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2647124 2647276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 2647652 2647768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1671 nt):
ATGGCCAGGACCACCAGCCAGCTGTATGACGCCGTGCCCATCCAGTCCAGCGTGGTGTTATGTTCCTGCC
CA
TCCCCATCAATGGTGAGGACCCAGACTGAGTCCAGCACGCCCCCTGGCATTCCTGGTGGCAGCAGGCA
G
GGCCCCGCCATGGACGGCACTGCAGCCGAGCCTCGGCCCGGCGCCGGCTCCCTGCAGCATGCCCAGCCT
CCG
CCGCAGCCTCGGAAGAAGCGGCCTGAGGACTTCAAGTTTGGGAAAATCCTTGGGGAAGGCTCTTTTT
CC
ACGGTTGTCCTGGCTCGAGAACTGGCAACCTCCAGAGAATATGCGATTAAAATTCTGGAGAAGCGACA
T
ATCATAAAAGAGAACAAGGTCCCCTATGTAACCAGAGAGCGGGATGTCATGTCGCGCCTGGATCACCCC
TTC
TTTGTTAAGCTTTACTTCACATTTCAGGACGACGAGAAGCTGTATTTCGGCCTTAGTTATGCCAAAA
AT
GGAGAACTACTTAAATATATTCGCAAAATCGGTTCATTCGATGAGACCTGTACCCGATTTTACACGGC
T
GAGATTGTGTCTGCTTTAGAGTACTTGCACGGCAAGGGCATCATTCACAGGGACCTTAAACCGGAAAAC
ATT
TTGTTAAATGAAGATATGCACATCCAGATCACAGATTTTGGAACAGCAAAAGTCTTATCCCCAGAGA
GC
AAACAAGCCAGGGCCAACTCATTCGTGGGAACAGCGCAGTACGTTTCTCCAGAGCTGCTCACGGAGAA
G
TCCGCCTGTAAGAGTTCAGACCTTTGGGCTCTTGGATGCATAATATACCAGCTTGTGGCAGGACTCCCA
CCA
TTCCGAGCTGGAAACGAGTATCTTATATTTCAGAAGATCATTAAGTTGGAATATGACTTTCCAGAAA
AA
TTCTTCCCTAAGGCAAGAGACCTCGTGGAGAAACTTTTGGTTTTAGATGCCACAAAGCGGTTAGGCTG
T
GAGGAAATGGAAGGATACGGACCTCTTAAAGCACACCCGTTCTTCGAGTCCGTCACGTGGGAGAACCTG
CAC
CAGCAGACGCCTCCGAAGCTCACCGCTTACCTGCCGGCTATGTCGGAAGACGACGAGGACTGCTATG
GC
AATTATGACAATCTCCTGAGCCAGTTTGGCTGCATGCAGGTGTCTTCGTCCTCCTCCTCACACTCCCT
G
TCAGCCTCCGACACGGGCCTGCCCCAGAGGTCAGGCAGCAACATAGAGCAGTACATTCACGATCTGGAC
TCG
AACTCCTTTGAACTGGACTTACAGTTTTCCGAAGATGAGAAGAGGTTGTTGTTGGAGAAGCAGGCTG
GC
GGAAACCCTTGGCACCAGTTTGTAGAAAATAATTTAATACTAAAGATGGGCCCAGTGGATAAGCGGAA
G
GGTTTATTTGCAAGACGACGACAGCTGTTGCTCACAGAAGGACCACATTTATATTATGTGGATCCTGTC
AAC
AAAGTTCTGAAAGGTGAAATTCCTTGGTCACAAGAACTTCGACCAGAGGCCAAGAATTTTAAAACTT
TC
TTTGTCCACACGCCTAACAGGACGTATTATCTGATGGACCCCAGCGGGAACGCACACAAGTGGTGCAG
G
AAGATCCAGGAGGTTTGGAGGCAGCGATACCAGAGCCACCCGGACGCCGCTGTGCAGTGA


Translation (556 aa):
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQP
P
PQPRKKRPEDFKFGKILGEGSFST
VVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHP
F
FVKLYFTFQDDEKL
YFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPEN
I
LLNEDMHIQITDFGTAKVLSPESKQ
ARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLP
P
FRA
GNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL
H
QQTPPKLTAYLPAMSEDDEDCYGN
YDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
S
NSFELDLQFSEDEKRLLLEKQAGGNP
WHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPV
N
KVLKGEIPWSQELRPEAKNFKTFFVHT
PNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser