NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS31224.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31224.1 Public Homo sapiens 10 DUSP13 12 104 71 CCDS HistoryNCBI Gene:51207Re-query CCDS DB by CCDS ID:31224.1Re-query CCDS DB by GeneID:51207

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 31224.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372700 ENSP00000361785 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372700Link to Ensembl Protein Viewer:ENSP00000361785Re-query CCDS DB by Nucleotide ID:ENST00000372700Re-query CCDS DB by Protein ID:ENSP00000361785
Original member Current member EBI,WTSI OTTHUMT00000390106 OTTHUMP00000233098 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000390106Link to Vega Protein Viewer:OTTHUMP00000233098Re-query CCDS DB by Nucleotide ID:OTTHUMT00000390106Re-query CCDS DB by Protein ID:OTTHUMP00000233098
Original member Current member NCBI NM_001007272.1 NP_001007273.1 Accepted alive Link to Nucleotide Sequence:NM_001007272.1Link to Protein Sequence:NP_001007273.1Re-query CCDS DB by Nucleotide ID:NM_001007272Re-query CCDS DB by Protein ID:NP_001007273Link to BLAST:NP_001007273.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001007273.1 248 Q9UII6-4 248 100% 0 0

Chromosomal Locations for CCDS 31224.1

Assembly GRCh37.p10 (GCF_000001405.22)

On '-' strand of Chromosome 10 (NC_000010.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 76854434 76854636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76855333 76855553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76857470 76857643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76868767 76868915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (747 nt):
ATGGCTGAGACCTCTCTCCCAGAGCTGGGGGGAGAGGACAAAGCCACGCCTTGCCCCAGCATCCTGGAGC
TG
GAGGAGCTCCTGCGGGCAGGGAAGTCTTCTTGCAGCCGTGTGGACGAAGTTTGGCCCAACCTTTTCAT
A
GGAGATGCGATGGACTCACTGCAGAAGCAGGACCTCCGGAGGCCCAAGATCCATGGGGCAGTCCAGGCA
TCT
CCCTACCAGCCGCCCACATTGGCTTCGCTGCAGCGCTTGCTGTGGGTCCGTCAGGCTGCCACACTGA
AC
CATATCGATGAGGTCTGGCCCAGCCTCTTCCTGGGAGATGCGTACGCAGCCCGGGACAAGAGCAAGCT
G
ATCCAGCTGGGAATCACCCACGTTGTGAATGCCGCTGCAGGCAAGTTCCAGGTGGACACAGGTGCCAAA
TTC
TACCGTGGAATGTCCCTGGAGTACTATGGCATCGAGGCGGACGACAACCCCTTCTTCGACCTCAGTG
TC
TACTTTCTGCCTGTTGCTCGATACATCCGAGCTGCCCTCAGTGTTCCCCAAGGCCGCGTGCTGGTACA
C
TGTGCCATGGGGGTAAGCCGCTCTGCCACACTTGTCCTGGCCTTCCTCATGATCTGTGAGAACATGACG
CTG
GTAGAGGCCATCCAGACGGTGCAGGCCCACCGCAATATCTGCCCTAACTCAGGCTTCCTCCGGCAGC
TC
CAGGTTCTGGACAACCGACTGGGGCGGGAGACGGGGCGGTTCTGA


Translation (248 aa):
MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAMDSLQKQDLRRPKIHGAVQA
S
PYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGD
AYAARDKSKLIQLGITHVVNAAAGKFQVDTGAK
F
YRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQ
GRVLVHCAMGVSRSATLVLAFLMICENMT
L
VEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser