NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS175.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
175.1 Public Homo sapiens 1 ATP13A2 11 103 68 CCDS HistoryNCBI Gene:23400Re-query CCDS DB by CCDS ID:175.1Re-query CCDS DB by GeneID:23400

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 175.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000326735 ENSP00000327214 Accepted alive Link to Ensembl Transcript Viewer:ENST00000326735Link to Ensembl Protein Viewer:ENSP00000327214Re-query CCDS DB by Nucleotide ID:ENST00000326735Re-query CCDS DB by Protein ID:ENSP00000327214
Original member Current member EBI,WTSI OTTHUMT00000006617 OTTHUMP00000002399 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000006617Link to Vega Protein Viewer:OTTHUMP00000002399Re-query CCDS DB by Nucleotide ID:OTTHUMT00000006617Re-query CCDS DB by Protein ID:OTTHUMP00000002399
Original member NCBI NM_022089.2 NP_071372.1 Accepted not alive Link to Nucleotide Sequence:NM_022089.2Link to Protein Sequence:NP_071372.1Re-query CCDS DB by Nucleotide ID:NM_022089Re-query CCDS DB by Protein ID:NP_071372Link to BLink:NP_071372.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_071372.1 1180 Q9NQ11-1 1180 100% 0 0

Chromosomal Locations for CCDS 175.1

Assembly GRCh37.p9 (GCF_000001405.21)

On '-' strand of Chromosome 1 (NC_000001.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 17312716 17312853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17312958 17313127 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17313300 17313451 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17313541 17313764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17314633 17314729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17314817 17314969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17316186 17316265 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17316382 17316498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17316622 17316782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17318229 17318353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17318504 17318624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17318738 17318897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17318981 17319076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17320124 17320330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17322471 17322659 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17322749 17322795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17322881 17322991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17323515 17323670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17326506 17326637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17326741 17326807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17326895 17327029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17328529 17328598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17328791 17328868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17330827 17330906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17331187 17331316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17331509 17331567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17331869 17332051 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17332179 17332273 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 17338224 17338233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3543 nt):
ATGAGCGCAGACAGCAGCCCTCTCGTGGGCAGCACGCCCACCGGTTATGGGACCCTGACGATAGGGACAT
CA
ATAGATCCCCTCAGCTCCTCAGTTTCATCCGTGAGGCTCAGCGGCTACTGTGGCAGTCCATGGAGGGT
C
ATCGGCTATCACGTCGTGGTCTGGATGATGGCTGGGATCCCTTTGCTGCTCTTCCGTTGGAAGCCCCTG
TGG
GGGGTGCGGCTGCGGCTCCGGCCCTGCAACCTGGCCCACGCCGAAACACTCGTTATCGAAATAAGAG
AC
AAAGAGGATAGTTCCTGGCAGCTCTTCACTGTCCAGGTGCAGACTGAGGCCATCGGCGAGGGCAGCCT
G
GAGCCGTCCCCACAGTCCCAGGCAGAGGATGGCCGGAGCCAGGCGGCAGTTGGGGCGGTACCAGAGGGT
GCC
TGGAAGGATACGGCCCAGCTCCACAAGAGCGAGGAGGCGGTGAGTGTCGGACAGAAGCGGGTGCTGC
GG
TATTACCTCTTCCAGGGCCAGCGCTATATCTGGATCGAGACCCAGCAAGCCTTCTACCAGGTCAGCCT
C
CTGGACCATGGCCGCTCTTGTGACGACGTCCACCGCTCCCGCCATGGCCTCAGCCTCCAGGACCAAATG
GTG
AGGAAGGCCATTTACGGCCCCAACGTGATCAGCATACCGGTCAAGTCCTACCCCCAGCTGCTGGTGG
AC
GAGGCACTGAACCCCTACTATGGGTTCCAGGCCTTCAGCATCGCGCTGTGGCTGGCTGACCACTACTA
C
TGGTACGCCCTGTGCATCTTCCTCATTTCCTCCATCTCCATCTGCCTGTCGCTGTACAAGACCAGAAAG
CAA
AGCCAGACTCTAAGGGACATGGTCAAGTTGTCCATGCGGGTGTGCGTGTGCCGGCCAGGGGGAGAGG
AA
GAGTGGGTGGACTCCAGTGAGCTAGTGCCCGGAGACTGCCTGGTGCTGCCCCAGGAGGGTGGGCTGAT
G
CCCTGTGATGCCGCCCTGGTGGCCGGCGAGTGCATGGTGAATGAGAGCTCTCTGACAGGAGAGAGCATT
CCA
GTGCTGAAGACGGCACTGCCGGAGGGGCTGGGGCCCTACTGTGCAGAGACACACCGGCGGCACACAC
TC
TTCTGCGGGACCCTCATCTTGCAGGCCCGGGCCTATGTGGGACCGCACGTCCTGGCAGTGGTGACCCG
C
ACAGGGTTCTGCACGGCAAAAGGGGGCCTGGTGAGCTCCATCTTGCACCCCCGGCCCATCAACTTCAAG
TTC
TATAAACACAGCATGAAGTTTGTGGCTGCCCTCTCTGTCCTGGCTCTCCTCGGCACCATCTACAGCA
TC
TTCATCCTCTACCGAAACCGGGTGCCTCTGAATGAGATTGTAATCCGGGCTCTCGACCTGGTGACCGT
G
GTGGTGCCACCTGCCCTGCCTGCTGCCATGACTGTGTGCACGCTCTACGCCCAGAGCCGACTGCGGAGA
CAG
GGCATTTTCTGCATCCACCCACTGCGCATCAACCTGGGGGGCAAGCTGCAGCTGGTGTGTTTCGACA
AG
ACGGGCACCCTCACTGAGGACGGCTTAGACGTGATGGGGGTGGTGCCCCTGAAGGGGCAGGCATTCCT
G
CCCCTGGTCCCAGAGCCTCGCCGCCTGCCTGTGGGGCCCCTGCTCCGAGCACTGGCCACCTGCCATGCC
CTC
AGCCGGCTCCAGGACACCCCCGTGGGCGACCCCATGGACTTGAAGATGGTGGAGTCTACTGGCTGGG
TC
CTGGAGGAAGAGCCGGCTGCAGACTCAGCATTTGGGACCCAGGTCTTGGCAGTGATGAGACCCCCACT
T
TGGGAGCCCCAGCTGCAGGCAATGGAGGAGCCCCCGGTGCCAGTCAGCGTCCTCCACCGCTTCCCCTTC
TCT
TCGGCTCTGCAGCGCATGAGTGTGGTGGTGGCGTGGCCAGGGGCCACTCAGCCCGAGGCCTACGTCA
AA
GGCTCCCCGGAGCTGGTGGCAGGGCTCTGCAACCCCGAGACAGTGCCCACCGACTTCGCCCAGATGCT
G
CAGAGCTATACAGCTGCTGGCTACCGTGTCGTGGCCCTGGCCAGCAAGCCACTGCCCACTGTGCCCAGC
CTG
GAGGCAGCCCAGCAACTGACGAGGGACACTGTGGAAGGAGACCTGAGCCTCCTGGGGCTGCTGGTCA
TG
AGGAACCTACTGAAGCCGCAGACAACGCCAGTTATCCAGGCTCTGCGAAGGACCCGCATCCGCGCCGT
C
ATGGTGACAGGGGACAACCTGCAGACAGCGGTGACTGTGGCCCGGGGCTGTGGCATGGTGGCCCCCCAG
GAG
CATCTGATCATCGTCCACGCCACCCACCCTGAGCGGGGTCAGCCTGCCTCTCTCGAGTTCCTGCCGA
TG
GAGTCCCCCACAGCCGTGAATGGCGTTAAGGATCCTGACCAGGCTGCAAGCTACACCGTGGAGCCAGA
C
CCCCGATCCAGGCACCTGGCCCTCAGCGGGCCCACCTTTGGTATCATTGTGAAGCACTTCCCCAAGCTG
CTG
CCCAAGGTCCTGGTCCAGGGCACTGTCTTTGCCCGCATGGCCCCTGAGCAGAAGACAGAGCTGGTGT
GC
GAGCTACAGAAGCTTCAGTACTGCGTGGGCATGTGCGGAGACGGCGCCAATGACTGTGGGGCCCTGAA
G
GCGGCTGATGTCGGCATCTCGCTGTCCCAGGCAGAAGCCTCAGTGGTCTCACCCTTCACCTCGAGCATG
GCC
AGTATTGAGTGCGTGCCCATGGTCATCAGGGAGGGGCGCTGTTCCCTTGACACTTCGTTCAGCGTCT
TC
AAGTACATGGCTCTGTACAGCCTGACCCAGTTCATCTCCGTCCTGATCCTCTACACGATCAACACCAA
C
CTGGGTGACCTGCAGTTCCTGGCCATCGACCTGGTCATCACCACCACAGTGGCAGTGCTCATGAGCCGC
ACG
GGGCCAGCGCTGGTCCTGGGACGGGTGCGGCCACCGGGGGCGCTGCTCAGCGTGCCCGTGCTCAGCA
GC
CTGCTGCTGCAGATGGTCCTGGTGACCGGCGTGCAGCTAGGGGGCTACTTCCTGACCCTGGCCCAGCC
A
TGGTTCGTGCCTCTGAACAGGACAGTGGCCGCACCAGACAACCTGCCCAACTACGAGAACACCGTGGTC
TTC
TCTCTGTCCAGCTTCCAGTACCTCATCCTGGCTGCAGCCGTGTCCAAGGGGGCGCCCTTCCGCCGGC
CG
CTCTACACCAATGTGCCCTTCCTGGTGGCCCTGGCGCTCCTGAGCTCCGTCCTGGTGGGCCTTGTCCT
G
GTCCCCGGCCTCCTGCAGGGGCCGCTGGCGCTGAGGAACATCACTGACACCGGCTTCAAGCTGCTGCTG
CTG
GGTCTGGTCACCCTCAACTTCGTGGGGGCCTTCATGCTGGAGAGCGTGCTAGACCAGTGCCTCCCCG
CC
TGCCTGCGCCGCCTCCGGCCCAAGCGGGCCTCCAAGAAGCGCTTCAAGCAGCTGGAACGAGAGCTGGC
C
GAGCAGCCCTGGCCGCCGCTGCCCGCCGGCCCCCTGAGGTAG


Translation (1180 aa):
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGIPLLLFRWKPL
W
GVRLRLRPCNLAHAETLVIEIRDKE
DSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEG
A
WKDTAQLHKSEEAVSVGQ
KRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQM
V
RKAIYGPNVISIPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRK
Q
SQTLRDMVKLSMRVCVCRPGG
EEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSLTGESI
P
VLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRT
GFCTAKGGLVSSILHPRPINFK
F
YKHSMKFVAALSVL
ALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRR
Q
GIFCIHPLRINLGGKLQLVCFDK
TGTLTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHA
L
SRLQDTPVGDPMDLKMVESTGW
VLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPF
S
SALQRMSVVVAWPGATQPEAYVKGSPELVAGLCNPET
VPTDFAQMLQSYTAAGYRVVALASKPLPTVPS
L
EAAQQLT
RDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQ
E
HLIIVHATHPERGQPASLEFLPMESPTAVNGVK
DPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKL
L
PK
VLVQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSM
A
SIECVPMVI
REGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSR
T
GPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQP
WFVPLNRTVAAPDNLPNYENTVV
F
SLSSFQYLILAAAVSKGAPFRRPLYTN
VPFLVALALLSSVLVGLVLVPGLLQGPLALRNITDTGFKLLL
L
GLVTLNFVGAFMLE
SVLDQCLPACLRRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser