NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5654.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5654.1 Public Homo sapiens 7 LMTK2 8 37.2 62 CCDS HistoryNCBI Gene:22853Re-query CCDS DB by CCDS ID:5654.1Re-query CCDS DB by GeneID:22853

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 5654.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000297293 ENSP00000297293 Accepted alive Link to Ensembl Transcript Viewer:ENST00000297293Link to Ensembl Protein Viewer:ENSP00000297293Re-query CCDS DB by Nucleotide ID:ENST00000297293Re-query CCDS DB by Protein ID:ENSP00000297293
Original member Current member EBI,WTSI OTTHUMT00000334560 OTTHUMP00000205379 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000334560Link to Vega Protein Viewer:OTTHUMP00000205379Re-query CCDS DB by Nucleotide ID:OTTHUMT00000334560Re-query CCDS DB by Protein ID:OTTHUMP00000205379
Original member Current member NCBI NM_014916.3 NP_055731.2 Accepted alive Link to Nucleotide Sequence:NM_014916.3Link to Protein Sequence:NP_055731.2Re-query CCDS DB by Nucleotide ID:NM_014916Re-query CCDS DB by Protein ID:NP_055731Link to BLink:NP_055731.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055731.2 1503 Q8IWU2 1503 100% 0 0

Chromosomal Locations for CCDS 5654.1

Assembly GRCh37.p2 (GCF_000001405.14)

On '+' strand of Chromosome 7 (NC_000007.13)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 97736490 97736592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97766627 97766754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97770709 97770853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97780694 97780767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97784070 97784188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97788650 97788737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97800853 97800986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97814363 97814447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97816189 97816310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97820040 97820189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97820926 97823884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97832886 97833018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97833256 97833498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 97834776 97834804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4512 nt):
ATGCCGGGGCCGCCGGCGTTGCGGCGGAGGCTGCTGCTGCTGCTGCTGGTCCTCCTGATCGCCGGCAGTG
CT
GGGGCCGCGCCACTTCCGCAAACAGGTGCAGGGGAGGCGCCACCTGCTGCAGAAGTTTCCTCATCTTT
T
GTGATCCTGTGTGTGTGCAGTTTAATAATATTAATAGTGTTAATTGCAAACTGTGTATCCTGCTGTAAG
GAC
CCAGAAATAGACTTTAAGGAATTTGAAGATAATTTTGATGATGAGATAGATTTCACACCACCAGCAG
AA
GACACTCCCTCTGTTCAGTCCCCAGCAGAGGTCTTCACACTTTCAGTACCAAATATTTCACTCCCAGC
T
CCCTCGCAATTCCAGCCTTCTGTAGAGGGATTGAAGTCTCAAGTTGCCCGCCACAGTCTAAACTACATA
CAG
GAAATTGGAAATGGCTGGTTTGGAAAGGTTCTCTTGGGAGAGATTTACACGGGCACTAGCGTAGCAA
GA
GTCATCGTGAAGGAGTTAAAAGCAAGTGCCAACCCAAAGGAACAAGATACTTTTTTGAAAAATGGAGA
A
CCTTACTACATTCTTCAGCATCCAAATATTCTTCAGTGTGTTGGACAGTGCGTAGAAGCGATTCCCTAC
CTC
CTGGTGTTTGAGTTCTGTGACTTGGGTGACCTGAAGGCGTATCTGCGCAGCGAGCAGGAGCACATGC
GG
GGGGACTCACAGACCATGCTGCTGCAGAGGATGGCGTGCGAGGTCGCCGCGGGGCTGGCCGCCATGCA
C
AAGCTGCACTTCCTGCACAGTGATTTAGCCCTGCGGAATTGTTTTCTCACCTCCGACTTAAATGTGAAA
GTG
GGAGATTACGGAATAGGATTCAGCAGGTACAAGGAGGATTATATTGAAACAGATGATAAAAAAGTTT
TC
CCTCTGCGATGGACTGCTCCAGAATTAGTAACCAGCTTTCAAGACAGACTGCTAACTGCAGATCAGAC
T
AAGTATAGTAATATCTGGTCTCTGGGTGTGACACTTTGGGAGCTTTTTGACAATGCCGCACAGCCGTAT
TCA
AACCTTTCCAACTTAGATGTCCTCAACCAAGTCATTAGAGAGAGAGACACAAAACTCCCGAAGCCCC
AG
CTGGAGCAGCCCTACTCTGATAGATGGTATGAAGTCTTACAGTTCTGTTGGCTGTCACCAGAAAAGAG
A
CCCGCGGCTGAAGATGTGCACAGGCTGCTGACTTACCTGCGGCTGCAGAGCCAGCGGGACTCAGAGGTC
GAC
TTTGAACAGCAGTGGAACGCTCTGAAGCCGAACACAAACAGCAGAGACTCCTCCAACAATGCTGCAT
TC
CCAATTCTCGACCACTTTGCCAGGGACCGGCTGGGTCGTGAAATGGAGGAAGTCCTCACCGTGACCGA
A
ACCAGCCAGGGCCTGAGCTTCGAGTATGTCTGGGAGGCCGCTAAGCACGACCACTTTGACGAGCGCAGC
CGG
GGCCACCTGGACGAAGGCTTGTCCTACACGAGCATCTTCTATCCGGTTGAAGTTTTTGAGAGTTCGC
TT
TCAGATCCTGGGCCCGGAAAGCAAGATGACAGCGGCCAGGATGTCCCCCTGAGGGTCCCTGGAGTGGT
T
CCTGTTTTTGATGCCCACAACCTTTCTGTTGGAAGCGACTATTATATCCAGTTAGAAGAAAAAAGTGGT
AGT
AACTTGGAGCTTGATTACCCACCAGCGCTGCTCACAACCGACATGGATAATCCAGAAAGGACTGGCC
CT
GAACTGTCCCAGCTCACGGCGCTCAGGAGCGTTGAACTTGAGGAGTCCAGTACAGATGAGGACTTCTT
C
CAAAGCAGTACAGACCCCAAAGACTCTAGCTTACCAGGGGACTTACACGTGACCAGTGGCCCCGAGAGC
CCT
TTCAACAATATATTTAATGATGTGGACAAATCGGAAGATTTGCCCAGTCACCAAAAAATATTCGACT
TA
ATGGAATTAAACGGAGTTCAAGCCGACTTTAAACCTGCCACTTTAAGTTCCAGTTTGGATAACCCCAA
A
GAGTCAGTCATAACAGGCCACTTTGAGAAAGAAAAGCCCCGTAAGATTTTTGACAGTGAGCCTCTCTGC
CTA
TCAGATAATCTTATGCACCAAGATAATTTTGATCCATTGAATGTTCAAGAATTGTCAGAAAACTTTT
TA
TTTCTTCAAGAGAAAAACTTACTAAAAGGCTCATTGTCCAGCAAAGAACACATAAATGATCTTCAGAC
A
GAACTTAAGAATGCTGGTTTTACTGAAGCTATGTTAGAAACGTCATGTAGAAACTCTTTAGATACTGAG
CTT
CAGTTTGCTGAAAATAAGCCAGGCTTGTCTTTGTTGCAGGAAAACGTAAGCACAAAGGGTGACGATA
CA
GATGTCATGCTCACAGGTGACACTTTGAGCACCTCATTGCAGTCTTCCCCGGAAGTGCAGGTACCTCC
T
ACCTCCTTCGAAACAGAAGAAACGCCCCGTCGGGTACCCCCAGACTCACTCCCAACACAGGGAGAAACC
CAG
CCCACGTGTTTAGATGTTATTGTCCCGGAGGACTGTCTCCACCAGGACATCAGTCCAGACGCTGTGA
CT
GTCCCGGTTGAAATTCTCTCAACTGATGCCAGAACCCACAGCCTGGATAACAGGTCCCAGGACTCTCC
T
GGCGAGAGTGAGGAGACCCTGCGACTCACCGAAAGTGACTCTGTTCTTGCTGATGACATCCTTGCCAGC
AGG
GTGAGTGTAGGGAGTAGTCTCCCGGAACTGGGACAGGAATTGCACAATAAACCATTTTCGGAAGACC
AT
CACAGTCATCGCCGGCTAGAGAAAAACTTAGAGGCTGTGGAGACTTTAAATCAGCTCAATTCTAAAGA
C
GCAGCAAAAGAAGCAGGCTTGGTGTCTGCCCTCTCCTCGGACTCAACCAGTCAGGACAGCCTCCTGGAG
GAC
AGCTTGTCAGCACCCTTCCCAGCCTCTGAGCCGTCCCTGGAAACCCCGGACTCTCTGGAGTCAGTGG
AT
GTCCACGAAGCGCTACTGGACTCTTTAGGATCTCACACTCCCCAGAAACTAGTGCCCCCCGATAAGCC
G
GCAGACAGTGGCTACGAAACAGAGAACTTGGAGTCTCCCGAGTGGACCTTGCATCCCGCTCCCGAGGGC
ACC
GCAGACTCAGAACCAGCCACCACGGGCGATGGCGGCCACAGCGGTCTGCCTCCCAACCCGGTCATTG
TC
ATCTCAGATGCCGGCGATGGTCACAGAGGCACAGAAGTGACCCCTGAGACGTTCACAGCTGGCTCCCA
G
GGTTCATACCGAGACTCTGCGTACTTCTCAGACAATGACTCTGAGCCCGAGAAAAGGTCTGAGGAGGTC
CCG
GGAACCTCCCCATCCGCCTTGGTGTTGGTACAGGAGCAGCCCCTACCCGAGCCAGTCCTCCCCGAGC
AA
AGTCCTGCTGCCCAGGATAGCTGCCTGGAAGCCAGAAAGAGCCAGCCAGATGAAAGTTGTCTGTCTGC
T
TTGCACAACTCCAGTGACCTGGAATTAAGAGCCACGCCGGAGCCAGCACAGACTGGTGTTCCCCAGCAG
GTG
CATCCCACGGAAGACGAGGCCAGCAGTCCCTGGAGTGTGCTGAATGCAGAACTTAGCAGCGGCGATG
AC
TTCGAGACACAGGACGATCGCCCCTGCACCCTCGCTTCCACGGGGACCAACACGAACGAACTCCTTGC
C
TACACCAATTCTGCGCTGGACAAGTCCCTGTCCAGCCACTCCGAGGGCCCGAAGTTGAAGGAGCCGGAC
ATC
GAAGGGAAGTACCTGGGGAAACTCGGGGTGTCAGGGATGCTCGACCTCTCAGAGGACGGGATGGATG
CA
GACGAGGAGGACGAAAACAGCGACGACTCGGACGAGGACCTGCGGGCCTTCAACCTGCATAGCCTCAG
C
TCCGAGTCGGAGGACGAGACCGAGCACCCCGTGCCCATCATCCTCAGCAACGAGGACGGAAGGCACCTG
CGG
AGTCTGTTGAAGCCCACAGCGGCCAATGCCCCCGACCCACTGCCCGAGGACTGGAAGAAGGAAAAGA
AG
GCAGTCACGTTTTTCGATGATGTCACAGTCTACCTGTTTGACCAGGAGACCCCAACCAAAGAGCTGGG
G
CCCTGTGGAGGAGAGGCGTGCGGCCCGGACCTGAGCGGCCCAGCCCCAGCCTCAGGCTCTCCCTACCTG
AGC
AGGTGCATCAACTCCGAAAGCTCCACCGACGAAGAAGGTGGTGGCTTTGAGTGGGATGATGACTTCT
CC
CCAGATCCTTTTATGTCAAAGACAACAAGTAACCTGCTCAGCTCCAAGCCTTCTCTCCAAACATCCAA
G
TACTTTTCTCCGCCGCCACCGGCCCGGAGCACGGAGCAGAGCTGGCCGCACTCGGCGCCTTACTCCCGG
TTC
TCCATCTCTCCCGCCAACATTGCCAGCTTTTCCCTCACACACCTGACCGACTCGGACATCGAGCAGG
GC
GGAAGCAGCGAAGACGGAGAAAAGGACTAG


Translation (1503 aa):
MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIVLIANCVSCCK
D
PEIDFK
EFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQFQPSVEGLKSQVARHSLNYI
Q
EIGNGWFGK
VLLGEIYTGTSVARVIVKELKASANPKEQDTFLKNGEPYYILQHPNILQCVGQCVEAIPY
L
LVFEFCDL
GDLKAYLRSEQEHMRGDSQTMLLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVK
V
GDYGIGFSRYK
EDYIETDDKKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPY
S
NLSNLDVLNQVIRERDTKLPKPQLEQPYSDR
WYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEV
D
FEQQWNALKPNTNSRDSSNNAAFPILDHFARDRLGREMEEVLTVTETSQGLSFEYVWEAAKHDHFDERS
R
GHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDSGQDVPLRVPGVVPVFDAHNLSVGSDYYIQLEEKSG
S
NLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEESSTDEDFFQSSTDPKDSSLPGDLHVTSGPES
P
FNNIFNDVDKSEDLPSHQKIFDLMELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLC
L
SDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTE
L
QFAENKPGLSLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGET
Q
PTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESDSVLADDILAS
R
VSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAKEAGLVSALSSDSTSQDSLLE
D
SLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQKLVPPDKPADSGYETENLESPEWTLHPAPEG
T
ADSEPATTGDGGHSGLPPNPVIVISDAGDGHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEV
P
GTSPSALVLVQEQPLPEPVLPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQ
V
HPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPD
I
EGKYLGKLGVSGMLDLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPIILSNEDGRHL
R
SLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQ
ETPTKELGPCGGEACGPDLSGPAPASGSPYL
S
RCINSESSTDEE
GGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSR
F
SISPANIASFSLTHLTDSDIEQG
GSSEDGEKD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser