NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3777.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3777.1 Public Homo sapiens 4 FBXW7 8 37.2 62 CCDS HistoryNCBI Gene:55294Re-query CCDS DB by CCDS ID:3777.1Re-query CCDS DB by GeneID:55294

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3777.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000281708 ENSP00000281708 Accepted alive Link to Ensembl Transcript Viewer:ENST00000281708Link to Ensembl Protein Viewer:ENSP00000281708Re-query CCDS DB by Nucleotide ID:ENST00000281708Re-query CCDS DB by Protein ID:ENSP00000281708
Original member NCBI NM_033632.2 NP_361014.1 Accepted not alive Link to Nucleotide Sequence:NM_033632.2Link to Protein Sequence:NP_361014.1Re-query CCDS DB by Nucleotide ID:NM_033632Re-query CCDS DB by Protein ID:NP_361014Link to BLink:NP_361014.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_361014.1 707 Q969H0-1 707 100% 0 0

Chromosomal Locations for CCDS 3777.1

Assembly GRCh37.p2 (GCF_000001405.14)

On '-' strand of Chromosome 4 (NC_000004.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

Chromosome Start Stop Links
4 153244033 153244301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153245336 153245546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153247158 153247383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153249360 153249541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153250824 153250937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153251884 153252020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153253748 153253871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153258954 153259088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153268082 153268223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153271194 153271276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 153332455 153332955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2124 nt):
ATGAATCAGGAACTGCTCTCTGTGGGCAGCAAAAGACGACGAACTGGAGGCTCTCTGAGAGGTAACCCTT
CC
TCAAGCCAGGTAGATGAAGAACAGATGAATCGTGTGGTAGAGGAGGAACAGCAACAGCAACTCAGACA
A
CAAGAGGAGGAGCACACTGCAAGGAATGGTGAAGTTGTTGGAGTAGAACCTAGACCTGGAGGCCAAAAT
GAT
TCCCAGCAAGGACAGTTGGAAGAAAACAATAATAGATTTATTTCGGTAGATGAGGACTCCTCAGGAA
AC
CAAGAAGAACAAGAGGAAGATGAAGAACATGCTGGTGAACAAGATGAGGAGGATGAGGAGGAGGAGGA
G
ATGGACCAGGAGAGTGACGATTTTGATCAGTCTGATGATAGTAGCAGAGAAGATGAACATACACATACT
AAC
AGTGTCACGAACTCCAGTAGTATTGTGGACCTGCCCGTTCACCAACTCTCCTCCCCATTCTATACAA
AA
ACAACAAAAATGAAAAGAAAGTTGGACCATGGTTCTGAGGTCCGCTCTTTTTCTTTGGGAAAGAAACC
A
TGCAAAGTCTCAGAATATACAAGTACCACTGGGCTTGTACCATGTTCAGCAACACCAACAACTTTTGGG
GAC
CTCAGAGCAGCCAATGGCCAAGGGCAACAACGACGCCGAATTACATCTGTCCAGCCACCTACAGGCC
TC
CAGGAATGGCTAAAAATGTTTCAGAGCTGGAGTGGACCAGAGAAATTGCTTGCTTTAGATGAACTCAT
T
GATAGTTGTGAACCAACACAAGTAAAACATATGATGCAAGTGATAGAACCCCAGTTTCAACGAGACTTC
ATT
TCATTGCTCCCTAAAGAGTTGGCACTCTATGTGCTTTCATTCCTGGAACCCAAAGACCTGCTACAAG
CA
GCTCAGACATGTCGCTACTGGAGAATTTTGGCTGAAGACAACCTTCTCTGGAGAGAGAAATGCAAAGA
A
GAGGGGATTGATGAACCATTGCACATCAAGAGAAGAAAAGTAATAAAACCAGGTTTCATACACAGTCCA
TGG
AAAAGTGCATACATCAGACAGCACAGAATTGATACTAACTGGAGGCGAGGAGAACTCAAATCTCCTA
AG
GTGCTGAAAGGACATGATGATCATGTGATCACATGCTTACAGTTTTGTGGTAACCGAATAGTTAGTGG
T
TCTGATGACAACACTTTAAAAGTTTGGTCAGCAGTCACAGGCAAATGTCTGAGAACATTAGTGGGACAT
ACA
GGTGGAGTATGGTCATCACAAATGAGAGACAACATCATCATTAGTGGATCTACAGATCGGACACTCA
AA
GTGTGGAATGCAGAGACTGGAGAATGTATACACACCTTATATGGGCATACTTCCACTGTGCGTTGTAT
G
CATCTTCATGAAAAAAGAGTTGTTAGCGGTTCTCGAGATGCCACTCTTAGGGTTTGGGATATTGAGACA
GGC
CAGTGTTTACATGTTTTGATGGGTCATGTTGCAGCAGTCCGCTGTGTTCAATATGATGGCAGGAGGG
TT
GTTAGTGGAGCATATGATTTTATGGTAAAGGTGTGGGATCCAGAGACTGAAACCTGTCTACACACGTT
G
CAGGGGCATACTAATAGAGTCTATTCATTACAGTTTGATGGTATCCATGTGGTGAGTGGATCTCTTGAT
ACA
TCAATCCGTGTTTGGGATGTGGAGACAGGGAATTGCATTCACACGTTAACAGGGCACCAGTCGTTAA
CA
AGTGGAATGGAACTCAAAGACAATATTCTTGTCTCTGGGAATGCAGATTCTACAGTTAAAATCTGGGA
T
ATCAAAACAGGACAGTGTTTACAAACATTGCAAGGTCCCAACAAGCATCAGAGTGCTGTGACCTGTTTA
CAG
TTCAACAAGAACTTTGTAATTACCAGCTCAGATGATGGAACTGTAAAACTATGGGACTTGAAAACGG
GT
GAATTTATTCGAAACCTAGTCACATTGGAGAGTGGGGGGAGTGGGGGAGTTGTGTGGCGGATCAGAGC
C
TCAAACACAAAGCTGGTGTGTGCAGTTGGGAGTCGGAATGGGACTGAAGAAACCAAGCTGCTGGTGCTG
GAC
TTTGATGTGGACATGAAGTGA


Translation (707 aa):
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN
D
SQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT
N
SVTNSSSIVDLPVHQLSSPFYTKTTK
MKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFG
D
LRAANGQGQQRRRITSVQPPTGLQEWLKMFQ
SWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDF
I
SLLPKE
LALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP
W
KSAYIRQHRIDTNWRRGELKSPK
VLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
T
GGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK
RVVSGSRDATLRVWDIET
G
QCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQ
FDGIHVVSGSLD
T
SIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQ
GPNKHQSAVTCL
Q
FNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL
D
FDVDMK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser