NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28070.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28070.1 Public Mus musculus 16 Dnajb11 21 106 86 CCDS HistoryNCBI Gene:67838Re-query CCDS DB by CCDS ID:28070.1See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28070.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004574 ENSMUSP00000004574 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004574Link to Ensembl Protein Viewer:ENSMUSP00000004574Re-query CCDS DB by Nucleotide ID:ENSMUST00000004574Re-query CCDS DB by Protein ID:ENSMUSP00000004574
Original member Current member EBI,WTSI ENSMUST00000166487 ENSMUSP00000126828 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166487Link to Ensembl Protein Viewer:ENSMUSP00000126828Re-query CCDS DB by Nucleotide ID:ENSMUST00000166487Re-query CCDS DB by Protein ID:ENSMUSP00000126828
Original member Current member EBI,WTSI ENSMUST00000178320 ENSMUSP00000137542 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178320Link to Ensembl Protein Viewer:ENSMUSP00000137542Re-query CCDS DB by Nucleotide ID:ENSMUST00000178320Re-query CCDS DB by Protein ID:ENSMUSP00000137542
Original member Current member EBI,WTSI OTTMUST00000063803 OTTMUSP00000031609 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000063803Link to Vega Protein Viewer:OTTMUSP00000031609Re-query CCDS DB by Nucleotide ID:OTTMUST00000063803Re-query CCDS DB by Protein ID:OTTMUSP00000031609
Original member Current member NCBI NM_001190804.1 NP_001177733.1 Accepted alive Link to Nucleotide Sequence:NM_001190804.1Link to Protein Sequence:NP_001177733.1Re-query CCDS DB by Nucleotide ID:NM_001190804Re-query CCDS DB by Protein ID:NP_001177733Link to BLAST:NP_001177733.1
Original member Current member NCBI NM_001190805.1 NP_001177734.1 Accepted alive Link to Nucleotide Sequence:NM_001190805.1Link to Protein Sequence:NP_001177734.1Re-query CCDS DB by Nucleotide ID:NM_001190805Re-query CCDS DB by Protein ID:NP_001177734Link to BLAST:NP_001177734.1
Original member Current member NCBI NM_026400.5 NP_080676.3 Accepted alive Link to Nucleotide Sequence:NM_026400.5Link to Protein Sequence:NP_080676.3Re-query CCDS DB by Nucleotide ID:NM_026400Re-query CCDS DB by Protein ID:NP_080676Link to BLAST:NP_080676.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001177733.1 358 Q99KV1 358 100% 0 0
NP_001177734.1 358 Q99KV1 358 100% 0 0
NP_080676.3 358 Q99KV1 358 100% 0 0

Chromosomal Locations for CCDS 28070.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 22858042 22858109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22862542 22862698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22865454 22865551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22866920 22867052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22868711 22868853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22869121 22869203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22869416 22869473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22870571 22870682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22870940 22871099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 22871671 22871735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1077 nt):
ATGGCCCCGCAGAACCTGAGCACCTTCTGCCTGTTGCTGCTGTACCTCATCGGGACTGTGATCGCCGGGC
GA
GATTTCTATAAGATCTTGGGGGTGCCTCGAAGTGCCTCCATAAAGGACATTAAAAAGGCCTACAGGAA
A
CTGGCCCTGCAGCTCCACCCTGACCGGAACCCTGATGACCCCCAAGCCCAGGAGAAATTCCAGGATCTA
GGT
GCTGCTTATGAGGTTCTGTCAGATAGTGAAAAACGAAAACAGTACGATACTTACGGTGAAGAAGGCT
TG
AAAGATGGCCATCAGAGCTCTCATGGGGACATTTTTTCACACTTCTTTGGAGACTTTGGCTTCATGTT
T
GGAGGAACCCCTCGTCAGCAGGACAGGAATATTCCAAGAGGAAGTGATATCATCGTAGATCTAGAAGTC
ACT
CTGGAAGAAGTGTACGCAGGAAATTTTGTGGAAGTAGTTAGAAACAAGCCTGTGGCCAGGCAGGCTC
CT
GGCAAACGGAAATGCAACTGTCGGCAAGAGATGAGAACCACACAGCTGGGACCGGGACGCTTCCAAAT
G
ACCCAGGAAGTGGTTTGTGACGAGTGCCCTAATGTCAAATTAGTGAATGAAGAACGAACACTAGAAGTG
GAA
ATAGAGCCTGGGGTGCGAGATGGCATGGAGTACCCCTTTATTGGAGAAGGTGAGCCGCATGTGGATG
GG
GAACCCGGAGACTTACGGTTCCGAATCAAAGTTGTCAAGCACCGGATATTTGAGAGGAGAGGGGATGA
C
CTGTACACAAATGTGACCGTCTCACTGGTTGAGGCTCTGGTTGGCTTTGAGATGGACATAACTCACCTG
GAT
GGTCACAAGGTCCATATTTCCCGGGACAAGATCACCAGGCCAGGAGCCAAGCTGTGGAAGAAAGGGG
AA
GGGCTGCCCAACTTTGATAACAATAACATCAAGGGCTCTTTGATAATCACTTTTGATGTGGACTTTCC
A
AAAGAACAGCTGACAGAGGAAGCAAAAGAAGGTATCAAGCAGCTTCTCAAACAAGGCCCCGTGCAGAAG
GTG
TACAACGGGCTGCAGGGCTATTAG


Translation (358 aa):
MAPQNLSTFCLLLLYLIGTVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL
G
AAYE
VLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV
T
LEEVYAGNFVE
VVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
E
IEPGVRDGMEYPFIGE
GEPHVDGEPGDLRFRIKVVKHRIFERRGDDLYTNVTVSLVEALVGFEMDITHL
D
GHK
VHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLLKQGPVQK
V
YNGLQGY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser