NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35922.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35922.1 Public Mus musculus 10 Ccar1 21 106 86 CCDS HistoryNCBI Gene:67500Re-query CCDS DB by CCDS ID:35922.1See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 35922.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020268 ENSMUSP00000020268 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020268Link to Ensembl Protein Viewer:ENSMUSP00000020268Re-query CCDS DB by Nucleotide ID:ENSMUST00000020268Re-query CCDS DB by Protein ID:ENSMUSP00000020268
Original member Current member NCBI NM_026201.3 NP_080477.1 Accepted alive Link to Nucleotide Sequence:NM_026201.3Link to Protein Sequence:NP_080477.1Re-query CCDS DB by Nucleotide ID:NM_026201Re-query CCDS DB by Protein ID:NP_080477Link to BLAST:NP_080477.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080477.1 1146 Q8CH18-1 1146 100% 0 0

Chromosomal Locations for CCDS 35922.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 62744763 62744822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62745263 62745468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62746901 62747086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62747344 62747464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62750547 62750693 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62750937 62751016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62751743 62751854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62753174 62753413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62756483 62756674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62760094 62760279 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62763440 62763523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62764324 62764534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62765267 62765433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62765942 62766055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62766557 62766782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62770855 62771016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62771936 62772065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62776568 62776760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62776849 62776963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62780441 62780634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62783234 62783266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62783883 62783927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62785431 62785594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 62790921 62790993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3441 nt):
ATGGCTCAGTTTGGAGGACAGAAGAATCCACCATGGGCTACTCAGTTTACAGCCACTGCGGTCTCACAAC
CA
GCTGCACTAGGTGTTCAGCAGCCATCACTTCTGGGAGCATCTCCTACCATTTATACCCAGCAGACTGC
A
TTGGCGGCGGCAGGCCTTACCACACAAACGCCAGCAAACTATCAGTTAACACAAACTGCGGCACTGCAG
CAA
CAAGCTGCAGCTGTATTACAGCAGCAATATTCACAACCTCAGCAGGCCTTGTATAGTGTGCAGCAGC
AG
TTGCAACAACCTCAGCAGACCATTTTAACACAGCCAGCTGTTGCATTGCCCACAAGCCTTAGCCTGTC
G
ACTCCTCAGCCTGCAGCACAGATTACTGTATCATATCCAACACCAAGGTCCAGTCAACAGCAAACTCAA
CCT
CAGAAGCAGCGTGTTTTCACAGGAGTGGTTACAAAGCTACATGATACATTTGGATTTGTGGATGAAG
AT
GTATTCTTTCAGCTTGGTGCTGTTAAAGGGAAAACCCCCCAAGTTGGTGATAGAGTATTGGTTGAAGC
A
ACTTATAATCCTAATATGCCTTTTAAATGGAATGCACAAAGAATTCAAACACTACCAAATCAGAATCAG
TCT
CAAACGCAACCTTTACTGAAGACTCCGACTGCTGTTATTCAGCCGATTGTGCCACAGACAACGTTTG
GT
GTTCAGGCACAGCCCCAACCCCAGTCATTATTGCAGGCCCAGATCTCAGCTGCCTCTATTACACCACT
A
TTGCAGACGCAGCCACAGCCCTTATTACAGCAGCCACAGCAGAAAGCTGGTTTATTGCAGCCTCCTGTC
CGA
ATAGTGTCACAGCCACAACCTGCGCGGAGATTAGATCCACCATCACGATTTTCAGGAAGAAACGACA
GA
GGGGATCAAGTACCTAATAGAAAAGATGACCGAAGTCGTGAAAGGGACAGAGAAAGACGCAGATCTAG
A
GAAAGATCACCTCAGAGGAAACGTTCCCGGGAGAGGTCACCCCGGAGAGAAAGAGAGCGCTCCCCTCGG
AGA
GTCCGTCGTGTCGTTCCACGGTACACAGTGCAGTTTTCAAAGTTTTCTTTAGATTGTCCCAGTTGTG
AC
ATGATGGAACTAAGGCGCCGTTATCAGAACTTATATATTCCTAGTGACTTTTTTGATGCTCAGTTTAC
A
TGGGTGGATGCTTTCCCTTTGTCAAGACCATTTCAACTGGGAAATTACTGCAATTTTTATGTGATGCAC
CGA
GAAGTAGAGTCCTTAGAAAAAAATATGGCTGTTCTTGATCCACCTGATGCTGACCACCTGTACAGTG
CA
AAGGTAATGCTGATGGCTAGCCCTAGTATGGAAGACTTGTATCATAAGTCATGTGCTCTTGCTGAAGA
C
CCACAAGACCTTCGTGATGGTTTTCAGCATCCTGCTAGACTTGTTAAGTTTCTAGTGGGAATGAAAGGC
AAG
GATGAAGCCATGGCCATTGGAGGCCACTGGTCTCCTTCGCTGGATGGACCAAACCCAGAAAAAGATC
CC
TCTGTGTTGATTAAAACTGCCATTCGTTGTTGTAAGGCTCTGACAGGCATTGATCTAAGTGTATGCAC
A
CAGTGGTACCGTTTTGCAGAGATTCGCTACCATCGCCCTGAGGAGACCCACAAGGGGCGTACAGTTCCA
GCT
CATGTGGAGACAGTGGTTTTATTTTTCCCGGATGTTTGGCATTGCCTTCCCACCCGCTCAGAGTGGG
AA
ACCCTCTCCCGAGGATACAAGCAGCAGCTGGTCGAGAAGCTTCAGGGTGAACGCAAGAAGGCTGATGG
A
GAACAGGATGAAGAAGAGAAGGATGATGGTGAAGTTAAAGAGATCGCCACTCCTACCCATTGGTCTAAG
CTT
GATCCAAAGGCAATGAAGGTAAATGATCTCCGAAAAGAATTAGAAAGTCGAGCTCTCAGTTCCAAAG
GA
CTAAAATCGCAGTTAATAGCTCGCCTAACAAAGCAGCTTAAAATAGAAGAACAAAAAGAAGAGCAGAA
G
GAATTAGAGAAGTCTGAAAAGGAAGAGGAAGATGAGGATGATAAGAAGTCTGAGGATGATAAAGAGGAA
GAA
GAAAGAAAACGTCAAGAAGAAGTGGAACGACAGCGTCAAGAAAGAAGATACATTTTGCCTGATGAAC
CT
GCCATAATTGTGCATCCGAACTGGGCTGCAAAAAGTGGCAAGTTTGATTGCAGCATCATGTCTTTGAG
T
GTCCTTTTGGATTACAGATTGGAAGATAATAAAGAACATTCTTTTGAGGTTTCACTGTTTGCAGAACTT
TTC
AATGAAATGCTTCAAAGAGACTTTGGGGTTAGAATATACAAATCATTACTCTCTCTTCCTGAGAAAG
AG
GACAAAAAAGATAAGGAGAAGAAAAGCAAAAAAGAAGAGAGAAAAGATAAAAAAGAAGAAAGAGAAGA
T
GATATTGATGAACCAAAACCAAAACGGAGAAAATCAGGCGACGATAAAGACAAAAAAGAAGACAGAGAT
GAG
AGAAAGAAAGAAGAAAAAAGAAAAGATGATTCTAAAGATGATGATGAAACTGAAGAAGATAACAATC
AA
GATGAGTATGACCCAATGGAGGCAGAGGAAGCTGAGGATGAAGATGACGATAGGGAGGAGGAGGAAGT
A
AAACGAGATGACAAAAGGGATGTCAGCCGGTACTGCAAGGACAGACCTGCGAAAGATAAGGAAAAAGAG
AAG
CCTCAAATGGTCACAGTTAACAGGGATCTGCTAATGGCCTTTGTTTATTTTGATCAAAGTCATTGCG
GT
TACCTTCTTGAAAAGGATTTGGAAGAAATACTATATACTCTTGGACTGCATCTTTCTCGGGCTCAGGT
A
AAGAAACTTCTTAATAAAGTAGTACTCCGAGAATCGTGCTTTTATCGGAAATTAACAGACACCTCGAAA
GAT
GATGAGAACCATGAAGAGTCAGAGGCACTGCAGGAAGACATGCTAGGAAACAGATTATTACTTCCAA
CA
CCAACAATAAAACAGGAATCAAAAGATGGAGAGGAAAATGTAGGGCTTATTGTGTACAATGGTGCAAT
G
GTGGATGTTGGGAGTCTCCTACAAAAACTGGAAAAGAGTGAGAAAGTAAGAGCTGAGGTGGAACAGAAG
CTC
CAGTTACTAGAGGAGAAAACAGATGAAGATGGGAAAACTATATTAAACTTGGAGAACTCTAACAAAA
GC
CTCTCTGGTGAACTTAGAGAGGTCAAAAAAGACCTTGGTCAATTACAAGAAAACCTGGAGGTTTCAGA
A
AACATGAATTTGCAATTTGAAAACCAATTGAATAAAACACTCAGAAACTTATCTACAGTTATGGATGAT
ATC
CACACTGTCCTCAAAAAGGATAATGTAAAGAGTGAAGACAGAGATGAGAAATCCAAGGAGAACGGCT
CA
GGTGTATGA


Translation (1146 aa):
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQ
Q
QAAAVLQQ
QYSQPQQALYSVQQQLQQPQQTILTQPAVALPTSLSLSTPQPAAQITVSYPTPRSSQQQTQ
P
QKQRVFTGVVTKLHDTFGFVDEDVFFQL
GAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQ
S
QTQPLLKTPTAVIQPIVPQTTFGVQAQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQK
AGLLQPPV
R
IVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDR
SRERDRERRRSRERSPQRKRSRERSPRRERERSPR
R
VRRVVPRYTVQFSKFSLD
CPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMH
R
EVESLEKNMAVLDPPDADHLYSAK
VMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVGMKG
K
DEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQ
WYRFAEIRYHRPEETHKGRTVP
A
HVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKADGEQ
DEEEKDDGEVKEIATPTHWSK
L
DPKAMK
VNDLRKELESRALSSKGLKSQLIARLTKQLKIEEQKEEQKELEKSEKEEEDEDDKKSEDDKEE
E
ERKRQEEVERQRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFE
VSLFAEL
F
NEMLQRDFGVRIYKSLLSLPEKEDKKDKEKKSKKEERKDKKEEREDDIDEPKPKRRKSGDDKDKKEDRD
E
RK
KEEKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEDDDREEEEVKRDDKRDVSRYCKDRPAKDKEKE
K
PQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ
VKKLLNKVVLRESCFYRKLTDTSK
D
DENHEESEALQEDML
GNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQK
L
QLLEEKT
DEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDD
I
HTVLKK
DNVKSEDRDEKSKENGSGV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser