NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37693.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37693.2 Public Mus musculus 17 Birc6 21 106 86 CCDS HistoryNCBI Gene:12211Re-query CCDS DB by CCDS ID:37693.2See the combined annotation on chromosome 17 in Sequence Viewer

Public Note for CCDS 37693.1
The coding region has been updated to extend the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 37693.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000180037 ENSMUSP00000136329 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000180037Link to Ensembl Protein Viewer:ENSMUSP00000136329Re-query CCDS DB by Nucleotide ID:ENSMUST00000180037Re-query CCDS DB by Protein ID:ENSMUSP00000136329
Original member Current member EBI,WTSI OTTMUST00000111659 OTTMUSP00000062557 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000111659Link to Vega Protein Viewer:OTTMUSP00000062557Re-query CCDS DB by Nucleotide ID:OTTMUST00000111659Re-query CCDS DB by Protein ID:OTTMUSP00000062557
Original member Current member NCBI NM_007566.3 NP_031592.3 Accepted alive Link to Nucleotide Sequence:NM_007566.3Link to Protein Sequence:NP_031592.3Re-query CCDS DB by Nucleotide ID:NM_007566Re-query CCDS DB by Protein ID:NP_031592Link to BLAST:NP_031592.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031592.3 4873 O88738-2 4873 100% 0 0

Chromosomal Locations for CCDS 37693.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 74528468 74528801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74546237 74546418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74548713 74548850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74557901 74558094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74561151 74561262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74562019 74562101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74565791 74566174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74573573 74573631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74579165 74580562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74585953 74586102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74589595 74589820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74593089 74593249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74594364 74594453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74594870 74595001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74596857 74597038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74598039 74598172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74598983 74599144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74599237 74599368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74599870 74599967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74602965 74603112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74604494 74604627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74605989 74606135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74608097 74608284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74609059 74609388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74609637 74609736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74610995 74611209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74611348 74611556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74611999 74612345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74613377 74613596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74614299 74614432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74615220 74615330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74618436 74618563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74619707 74619838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74622036 74622251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74622909 74623092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74623751 74623906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74625106 74625239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74626962 74627115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74629405 74629521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74630960 74631114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74631611 74631737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74634796 74634906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74635763 74635896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74638343 74638470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74639780 74640342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74641633 74641808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74642261 74642357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74642492 74642686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74643295 74643495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74646469 74646748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74647204 74647460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74647717 74647825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74648118 74648339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74649623 74650403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74651908 74652051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74652617 74652746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74654389 74654520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74655172 74655339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74658178 74658351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74659159 74659355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74660382 74660682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74662601 74662818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74668759 74668923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74670214 74670382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74677166 74677379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74689218 74689363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74690358 74690468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74691002 74691219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74692184 74692345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74693448 74693525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74696237 74696425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74697385 74697519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 74702204 74702383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (14622 nt):
ATGGTGACTGGCTGTGGTGCTGCACCTCCCGGGACTGTCACTGAGCGGCTTCCCAGTGTGATTGTGCTGA
GC
GCAGGCCGGAAGATGGCGGCTGCGGCTGCGGAGGCCTCGGGCCCGAGCTGCTCCTCCGCGGCGGCGGC
G
GCAGGGGCGGGGGCGGCCGGGGTCTCCGAGTGGCTGGTGCTGCGGGATGGCTGCATGCGCTGCGACGCC
GAC
GGGCTGCACAGCCTCTCCTACCACCCGGCGCTTAACGCCATCCTGGCCGTCACCAGCCGCGGGACCA
TC
AAAGTCATCGACGGCACGTCCGGGGCCACCCTTCAGGCCTCGGCGCTCAGCGCTAAACCAGGTGGACA
G
GTGAAATGTCAGTATATTTCTGCTGTGGATAAAGTGATATTTGTGGATGATTACGCCGTGGGCTGTAGG
AAG
GACCTTAATGGGATCTTGTTGCTAGACACTGCTCTGCAAACTCCAGTTTCAAAGCAGGACGATGTGG
TT
CAGCTGGAACTTCCCGTCACAGAGGCACAGCAGCTCTTATCAGCATGTATAGAAAAGATAGATGTTTC
T
AGTACAGAGGGTTATGATTTGTTCATCACACAGCTCAAAGATGGTTTAAAAAATACATCTCATGAAACT
GCA
GCAAACCATAAAGTTGCTAAGTGGGCCACAGTTACATTTCATCTTCCTCATCACGTATTGAAGTCTA
TT
GCCAGTGCCATTGTAAATGAACTTAAGAAAATAAATCAAAATGTTGCTGCCTTACCTGTGGCGTCCTC
A
GTGATGGACAGATTGTCTTACCTCTTGCCCAGTGCACGTCCAGAACTTGGAGTTGGGCCAGGCCGTTCT
GTA
GACAGGGCATTGATGTATAGTGAAGCTAACAGAAGGGAGACCTTCACTTCGTGGCCTCATGTTGGCT
AT
AGGTGGGCACAGCCAGATCCCATGGCTCAAGCTGGATTTTATCACCAGCCTGCTTCATCTGGAGATGA
T
AGAGCCATGTGTTTTACTTGTAGTGTTTGCCTCGTTTGTTGGGAGCCTACGGATGAACCTTGGTCCGAA
CAT
GAGAGACACTCTCCCAACTGTCCCTTTGTGAAGGGTGAGCACACCCAGAATGTGCCCTTGTCAGTCA
CC
CTGGCAACGAGTCCTGCGCAGCTCCCTTCTGCAGATGGAGCTGACAGAATAGCTTGCTTTGGGTCTGG
G
AGCTGTCCTCAGTTTCTAGCTGCTGCAACCAAACGTGGGAAGATCTGCATATGGGACGTCTCCAAACTC
ATG
AAGGTGCACTTGAAGTTTGAAATTAATGCCTATGACCCAGCAATCGTGCAACAGCTGATCCTATCAG
GA
GACCCAAGTTCAGGAGTTGATTCAAGGAGACCCACTTTGGCATGGCTGGAAGACTCTTCTAGTTGCTC
A
GACATACCGAAACTGGAAGGAGACAGTGATGATTTGCTGGAGGATTCAGACAGTGAAGAGCATTCCAGA
TCG
GATTCTGTGACAGGGCATACATCACAGAAGGAAGCCATGGAAGTAAGCCTTGATATAACAGCTCTCA
GC
ATTCTCCAGCAGCCAGAAAAACTGCAGTGGGAGATTGTGGCTAATGTGCTTGAAGATACTGTTAAGGA
T
CTTGAAGAACTTGGGGCAAACCCCTCCCTAACGAACTCTAAGAGTGAAAAGACAAAGGAAAAGCACCAG
GAA
CAACACAACATTCCCTTCCCCTGTTTATTGGCTGGAGGTTTATTAACATATAAGTCTCCTGCTACCT
CA
CCCATTAGTAGTAATTCTCACAGGTCACTGGATGGTTTAAGCAGAACTCAGGGCGAAAGTATATCAGA
A
CAAGGGTCAACTGACAATGAATCCTGCACAAATTCAGAGCTGAATTCTCCTCTGGTCAGGAGGACTTTA
CCT
GTGTTACTTCTTTATAGTATCAAAGAATCTGATGAGAAAGCAGGAAAAATCTTTTCACAGATGAACA
AT
ATCATGAGTAAAAGTTTGCACGATGACGGTTTTACAGTTCCTCAGATTATTGAAATGGAGCTGGACAA
C
CAGGAGCAGCTGTTGTTACAGGATCCGCCTGTGACTTACATCCAGCAGTTTGCAGATGCAGCCGCCAGC
CTC
ACTTCTCCAGATTCCGAGAAGTGGAACTCTGTGTTCCCCAAGCCTGGGGCTTTGGTGCAGTGCTTGA
GG
CTACCAAAGTTTGCAGAGGAGGAGACTCTTTGTATAGACTCTATAACTCCTTGTGCTGATGGAATTCA
T
TTGTTGGTAGGACTGCGGACATGCTCTGTGGAATCATTGAGTGCAATAAATCAAGTCGAGGCCTTGAAT
AAT
TTAAATAAATTAAACTCTGCACTATGTAATAGACGTAAAGGTGATCTGGAATCCAATCTTGCTGTAG
TG
AATGGTGCAAATATCAGTGTGATCCAACATGAGTCACCAGCAGATGTGCCGGAGCATCTGCTCATCCG
G
CCGGAGCAGAGGAATGTCGTCAGTGGTGGATATTTAGTTCTTTACAAGATGAACTATACCACTCGAATA
GTG
ACTTTAGAAGAGGAGCCCGTGAAAATCCAACATATCAAAGATCCCCAGGACACAATTACCTCGCTCA
TT
TTGCTTCCACCAGATATACTGGATAATCGAGAGGATGACTGTGAGGAACCTGCTGAGGAAATGCAGTT
A
GCCTCAAAGAATGGGATTGAAAGAGAAAAAAAGTCTGACATTTCTACGCTTGGACACCTGGTAGTAACC
ACT
CAGGGAGGATACGTGAAAGTATTAGACCTTTCAAACTTCGAAATTTTGGCCAAAGTGGAGCCTCCCA
AA
AAGGAGGGCACTGAAGAACAGGATACATTTGTTTCTGTCATTTACTGCTCAGGCACAGACAGGCTGTG
T
GCGTGCACCAAAGGTGGTGAGCTTCATTTTCTCCAAATTGGAGGAACCTGTGATGATATTGATGAAGCT
GAT
ATTCTGGTAGATGGATCCCTTTCTAAAGGAATAGAACCAGCTCTAGAAGGTTCCAGACCTTTATCAA
AT
CCTTCAAGTCCTGGTATTTCAGGAGTTGAGTTATTGGTGGACCAGCCTTTCACACTTGAAATCTTGAC
G
TCTTTAGTAGAACTAACTCGATTTGAAACACTGACTCCACGATTTTCAGCAACTGTTCCTCCATGTTGG
GTA
GAAGTTCAGCAAGAACAGCAGCAAAGAAGGCACCCGCAGCATCTGCACCAGCAGCACCACGGCGATG
CT
GCTCAGCACACCCGGACCTGGAAACTGCAGACCGACAGCAACAGCTGGGATGAACATGTGTTTGAATT
G
GTTCTACCTAAAGCCTGTATGGTTGGACATGTGGACTTCAAATTCGTTCTGAACTCCAACATCACCAGT
GTC
CCCCAGATACAAGTGACACTGCTGAAGAACAAAGCTCCAGGCCTAGGGAAAGCCAATGCTCTTAACA
TT
GAAGTGGAACATAATGGGAACCCGTCCCTGGTTGATTTGAATGAAGAAATGCACCACATGGATGTAGA
G
GAGTCACAGTGTCTTAGGTTATGTCCATTCTTAGAGGATCATAAAGAAGACATTCTGTGTGGCCCAGTA
TGG
CTTGCTAGTGGTCTGGACCTATCAGGTCATGCTGGGATGTTGACGTTGACAAGCCCCAAACTTGTTA
AA
GGTATGGCAGGAGGGAAGTACCGTTCATTTTTAATTCATGTCAAAGCAGTGAGTGACCGAGGAGCAGC
A
GATGAGATGTGCAGCAGTGGCCTGCGTCCTGTTGTGAGGCTTCCATCTCTTAAACAGCAGGGTCACAAG
GGA
TACTCACTGGCTTCTCTCTTGGCCAAAGTTGCAGCAGGCAAGGAAAAATCATCTAATGTTAAAAATG
AA
AATGCAGGAGGCACCCGAAAGTCTGAAAACCTGCGGGGTTGTGATTTACTTCAGGAGGTGTCTGTCAC
C
ATTCGGAGGTTTAAGAAAACCTCCATCTGTAAGGAAAGGGTTCAGCGTTGCGCCATGTTACAGTTTTCA
GAA
TTTCATGAGAAGCTTCTTAACACGCTTTGTAGACGATCAGATGATGGGCAGGTCACAGAGCACGCCC
AG
AGTCTTGTGTTGGATGCTCTCTGCTGGTTAGCAGGAGTCCATTCAAATGGATCTGGCAGCTCAAAGGA
A
GGAAATGAGTGCCTACTTTCAAAAACACGGAAATGTCTTTCCGATATTGTCCGTGTATGCTTCTTTGAG
GCA
GGACGAAGTATAGCCCATAAATGTGCTCGGTTTCTAGCCTTGTGCATTAGTAATGGCAAATGCGAGC
CC
TGTCAGCCTGGATTTGGATCGGTTCTATTGAAGGCTTTACTTGATAATATGTGCTTTTTACCAGCAGC
A
GCAACTGGTGGTTCTGTCTACTGGTATTTTGTACTGCTGAATTATGTTAAGGACGAAGACCTGGCTGGA
TGC
AGCACAGCGTGTGCAGCCCTACTTACGGCTGTGTCCAGACAGCTGCAGGACAGGCTAACGCCGCTGG
AG
GCTCTGCTTCAAACAAGATATGGACTGTACAGCTCCCCGTTTGATCCAGTTCTCTTTGACTTGGAGAT
G
AGCGGCTCTTCTTGGAAAACTGTGTACAGTAGCAGCACTGCTGTCCAGTCAGATGAAATCGACTTATCA
GAC
GTTCTTTCAGGGAATGGAAGAGTCAGCAGTTGCACGGCTGCGGAGGGAAGCTTCACATCTCTCACGG
GG
CTTCTAGAGGTTGAACCTCTTCACTTTACTTGCGTGTCAACCAGTGATGGGACCAGAATAGAAAGGGA
T
GATGCAAGTACGTTTACTGTGAGTTCCTTCGGGGTTCCTCCTGCAGTAGGTGGCCTATCATCTGGCACA
GTT
GGGGAAGCCTCGACAGCCCTGAGTTCAGCAGCCCAGGTAGCTTTGCAGTCTCTCTCTCATGCAATGG
CT
TCAGCCGAGCAACAGCTGCAGGTGCTGCAAGAGAAACAGCAGCAGCTTTTGAAGCTTCAGCAACAGAA
A
GCAAAGCTGGAAGCCAAGCTGCATCAGACAACAGCGGCAGCAGCAGCAGCTGCATCAGCAGCGGCAGCA
GCA
GCAGCAGGTCCTGTTCACAATGCAGTGCCTTCCAACCCAGTGGCTGCTCCTGGATTCTTCATCCATC
CA
TCTGATGTTATTCCCCCCACTCCAAAAACAACACCACTCTTTATGACTCCACCGCTGACTCCGCCCAA
C
GAAGCTGTTTCTGTTGTGATTAATGCTGAGCTTGCCCAGCTTTTCCCAGGCTCAGTCATTGATCCTCCC
GCA
GTGAATCTTGCTGCACAGAACAAAAACTCCAGCAAATCTAGAATGAATCCACTTGGTTCTGGCCTGG
CC
CTTGCAATTTCTCATGCCTCACATTTTCTTCAGCCGCCACCTCACCAGTCCATTATTATAGAGCGAAT
G
CATTCAGGAGCCAGGAGATTTGTCACCCTGGATTTTGGAAGACCTATACTGCTGACAGATGTACTGATT
CCT
ACTTGTGGAGACTTGGCGTCTTTATCAATTGACATATGGACATTAGGGGAAGAAGTAGATGGAAGGC
GT
TTGGTTGTGGCAACTGATATCAGTACTCATTCACTAATTCTTCATGACTTAATACCTCCACCTGTATG
C
AGATTCATGAAGATAACTGTCATTGGACGCTATGGAAGCACAAATGCCAGAGCAAAGATCCCCTTGGGA
TTT
TACTACGGGCACAGCTATATCTTACCTTGGGAAAGTGAGCTGAAGTTGATGCACGACCCTCTCAGAG
GC
GAAGGAGAATCTGCCAGCCAGCCAGAAATTGACCAGCATTTAGCAATGATGGTTGCTCTACAAGAAGA
T
ATACAGTGCAGATATAACCTAGCCTGTCATCGTCTGGAAGCTCTTTTGCAGAGTATTGATCTTCCTCCG
CTC
AATAGTGCTAACAATGCACAGTACTTTTTGAGAAAACCAGACAAAGCAGTCGAGGAAGACAGTAGAG
TT
TTTTCTGCTTATCAAGATTGCATTCAGCTACAGCTTCAATTAAATCTGGCTCATAATGCAGTGCAGAG
G
CTCAAAGTAGCCATAGGTGCAAGTCGGAAGTTGTTGAATGAAACATCAGGTCCAGAAGACCTGATTCAG
ACG
TCATCCACAGAGCAGTTACGCACCATTGTGAGATACTTACTGGATACACTGCTCAGCCTCCTGCACT
CT
TCCAATGGGCATTCTGTTCCTGCAGTTTTACAGAGTACCTTTCACGCTCAGGCCTGTGAAGAACTGTT
T
AAACACTTGTGCATCAGTGGGACCCCAAAGATACGGTTGCATACTGGCCTGCTCCTTGTTCAGCTATGT
GGT
GGTGAGAGATGGTGGGGCCAGTTTCTTTCTAACGTTCTTCAGGAACTGTATAATTCAGAGCAGCTTC
TC
ATCTTCCCACAAGATAGGGTCTTTATGTTACTCTCCTGCATTGGACAGCGATCACTTAGTAACAGTGG
A
GTATTGGAAAGTTTACTAAACCTCTTGGACAATTTATTGTCACCTCTTCAGCCAGAGTTAAGCATGCAC
AGA
AGGACAGAAGGAGTCCTGGACATTCCCATGATCAGTTGGGTTGTTATGCTGGTGTCCAGGTTACTGG
AT
TATGTGGCCACTGTTGAAGATGAAGCAGCTGCTGCAAAGAAACCTTTGAATGGTAACCAATGGAGTTT
T
ATTAACAATAATCTGCATACTCAGAACTTAAATAGATCCTCCAAGGGAGGCAGTAGCCTCGATAGATTA
TAT
TCCAGAAAAATCAGAAAGCAGCTTGTCCATCATAAGCAGCAACTTAACCTACTAAAGGCAAAACAGA
AG
GCTTTGGTGGAACAGATGGAAAAAGAAAAAATACAGAGTAACAAAGGCTCATCATATAAACTGCTAGT
A
GAGCAAGCAAAACTGAAGCAGGCGACCTCCAAGCATTTTAAGGATTTGATTCGCTTGCGCCGGACAGCA
GAA
TGGTCTCGTTCTAATTTAGACACTGAAGTTACAACAACAAAAGAGAGCCCTGAGATTGAGCCTCTTC
CA
TTTACTCTGGCCCATGACCGTTGTATCTCAGTAGTGCAAAAGCTCGTCCTGTTTCTTCTTTCCATGGA
T
TTCACCTGCCATGCAGACCTCTTACTGTTTGTCTGCAAGGTTCTTGCACGCATTGCAAATGCGACCAGG
CCA
ACTATTCATCTGTGTGAAATTGTGAATGAGCCGCAGTTAGAAAGACTGTTATTGCTTCTGGTTGGAA
CT
GACTTCAACAGAGGAGACATCTCTTGGGGTGGTGCCTGGGCTCAGTATTCTTTAACCTGTATGCTGCA
G
GACATTCTAGCAGGAGAATTGTTGGCTCCGGTGGCTGCAGAAGCGATGGAAGAATGCACTGTGAGTGAG
GAT
GTTGGTGCAACAGCTGGCGACTCTGATGACTCCCTGCAGCAGTCCCCCGCTCAGCTGCTGGAAACCA
TA
GATGAACCATTGACACATGAGATAGCAGGTACGCCTCCTCTCTCTTCCTTGGAAAAAGATAAGGAAAT
T
GACCTTGAGCTACTTCAAGACCTCATGGAAGTTGACATTGATCCTTTAGATATTGATCTAGAAAAGGAT
CCT
CTTGCAGCCAAAGTTTTTAAGCCTATAAGCAGTACATGGTATGACTACTGGGGTGCTGATTATGGTA
CC
TATAATTATAATCCTTACATTGGAGGCCTGGGGATGCCTGTAGCAAAACCACCATCAAACACAGAGAA
G
AATGGATCCCAGACTGTCAGTGTTTCGGTGTCTCAGGCTTTAGATGCTCGTCTAGAAGTTGGTCTTGAA
CAG
CAAGCAGAACTTATGTTGAAAATGATGTCTACTCTGGAAGCAGACTCCATCTTACAAGCATTAACAA
AT
ACATCTCCTACCTTTTCACAATCTCCAACTGGAACAGATGACTCACTTCTGGGGAATTTACAGCCAGC
A
AACCAGAACAGCCAGCTCATGATACAGCTCTCATCTGTCCCAATGTTAAATGTTTGTTTCAATAAACTC
TTC
TCCATGCTTCAAGTCCATCATGTTCAGTTGGAGTCACTTCTTCAGTTGTGGCTCACATTGAGCCTTA
AT
TCTAGTTCATCAGGGAACAAAGAGAATGGAGCAGATATTTTTTTATATAATGCTAATCGGATACCTGT
C
ATCTCATTAAATCAAGCATCAATAGCTAGCTTTCTCACAGTGCTAGCTTGGTATCCAAATACTTTGCTC
CGG
ACGTGGTGCCTTGTGCTTCATAGCTTAACACTCATGACGAATATGCAGCTTAATTCTGGTTCCAGCA
GT
TCTATTGGAATTCAGGAGACTACGGCTCATCTGTTGGTTTCAGATCCAAACCTTATTCATGTGTTAGT
G
AAATTTCTTTCTGGTACCAGTCCTCATGGGACGAATCAGCATAGCCCACAGGTTGGTCCAACAGCTACA
CAA
GCCATGCAGGAATTTCTCACCCGACTACAAGTGCATTTGTCTTCAACATGTCCCCAGATATTCAGTG
AA
CTTTTGCTCAAGTTAATTCACATACTGTCCACAGAAAGGGGGGCCTTCCAGACAGGGCAAGGACCTCT
T
GATGCCCAAGTGAAGCTGTTAGAGTTTACTCTGGAGCAGAACTTTGAAGTTGTCTCAGTTAGTACGATT
TCT
GCTGTGATAGAGTCTGTCACCTTCTTGGTGCATCATTACATCACTTGCTCCGACAAAGTCATGTCTA
GA
AGTGGGTCAGACAGCTCTGCCGGTGCTCGGGCTTGCTTTGGGGGACTCTTTGCTAACCTCATTCGTCC
A
GGTGATGCAAAAGCTGTTTGTGGTGAAATGACAAGAGATCAACTCATGTTTGATTTGTTAAAACTTGTT
AAC
ATTTTAGTACAGCTGCCTCTTTCAAGCAATAGGGAATACAGCGCAAGAGTGTCCGTGACCACCAATA
CA
ACAGATAGTGTTTCAGATGAAGAAAAAGTCTCAGGAGGCAAAGATGTCAATGGAAGCAGTGCCAGCAC
T
CCAGGATCTCCTGCATGTGTTGCTGACTTAGTCTTAGCCAACCAGCAAATTATGAGCCAGATTCTGTCT
GCC
CTAGGCCTGTGTAATAGCAGTGCCATGGCAATGATAATTGGTGCAAGTGGCTTACATCTCACCAAAC
AT
GAGAACTTCCATGGTGGGTTAGATGCCATATCAGTTGGAGATGGATTATTTACCATATTGACAACACT
T
AGTAAGAAAGCCTCTACAGTCCACATGATGTTGCAGCCAATCTTGACCTACATGGCCTGTGGATACATG
GGC
AGACAAGGCTCTCTTGCTACTTGCCAGTTATCTGAGCCATTGTTGTGGTTTATCTTGAGAGTGTTGG
AT
ACTAGTGATGCATTGAAAGCTTTCCATGATATGGGTGGAGTTCAGCTCATATGCAATAATATGGTTAC
C
AGTACAAGGGCTATTGTGAACACTGCAAGAAGTATGGTATCAACTATTATGAAATTTCTTGATTCTGGA
CCA
AATAAAGCTGTTGACAGCACTTTGAAAACAAGGATCCTGGCCTCTGAGCCTGACAATGCAGAAGGAA
TC
CATAACTTTGCACCACTTGGTACCATCACTTCTAGTAGTCCTACTGCCCAGCCAGCTGAGGTGCTCCT
G
CAAGCCACACCGCCCCATCGAAGAGCTCGTTCTGCTGCTTGGTCCTACATCTTTCTGCCTGAGGAAGCC
TGG
TGTGACCTTACCATCCACCTTCCGTCAGCAGTGCTGCTGAAGGAGATACACATTCAACCTCACCTCG
CA
TCTCTCGCAACCTGCCCATCGTCAGTGTCTGTTGAAGTAAGTGCAGATGGTGTTAATATGCTCCCTTT
G
TCTACTCCTGTTGTCACAAGCGGTCTCACCTACATAAAAATTCAGCTTGTCAAAGCCGAAGTAGCTTCT
GCT
GTCTGCCTCAGACTCCATCGTCCTCGGGACGCCAGCACACTAGGCCTCTCACAGATTAAATTATTAG
GC
CTTACTGCTTTTGGTACCACCTCATCAGCCACAGTTAATAATCCCTTTCTTCCATCTGAAGATCAAGT
T
TCTAAAACAAGCATTGGATGGTTACGGTTATTACATCATTGCCTTACACATATAAGTGATCTAGAAGGG
ATG
ATGGCCAGTGCAGCTGCCCCTACTGCCAACCTGCTGCAGACTTGTGCTGCCTTACTGATGTCTCCAT
AC
TGTGGGATGCATTCCCCCAACATTGAGGTTGTGCTGGTAAAGATTGGGTTGCAGTCCACTAGAATTGG
C
CTGAAGCTTATTGACATTCTCCTGAGGAATTGCGCAGCATCAGGCAGCGATCCTACAGATTTAAATAGC
CCT
TTACTTTTTGGAAGGCTGAATGGACTGTCCTCTGATTCTACAATAGATATTCTTTACCAGCTTGGTA
CA
ACTCAGGATCCTGGAACTAAAGACAGAATTCAGGCCTTGCTAAAGTGGGTCAGTGACTCTGCAAAAAT
G
GCTGCTTTGAAGAGAAGTGGCAGAATGAACTATATGTGCCCGAGCTCATCAGCTGTCGAGTATGGTCTT
CTC
ATGCCATCCCCCTCTCATTTGCACTGTGTAGCAGCGATTCTTTGGCACAGTTATGAACTGCTGGTGG
AG
TATGATTTGCCAGCACTGCTAGACCGAGAGCTCTTTGAGTTACTTTTTAATTGGTCCATGTCACTTCC
A
TGCAACGTGGTTTTGAAGAAAGCTGTTGACAGTCTGCTTTGCTCCATGTGCCATATACATCCAAATTAT
TTT
TCCTTGCTCATGGGCTGGATGGGAATTATCCCTCCTCCGGTGCAGTGTCATCATAGACTATCCATGA
CA
GATGATAGCAAGAAGCAAGATCTTAGTTCATCATTGACAGATGACTCCAAAAATGCACAAGCACCTCT
G
TCTCTAACTGAATCCCACTTGGCAACTCTTGCTTCTTCTTCTCAGTCCCCAGAAGCTATCAAACAGTTG
CTA
GACTCGGGGTTGCCTTCCCTTCTCGTGAGGAGTCTGGCTAGCTTTTGTTTTAGTCACATTTCTTACT
CA
GAAAGCATTGCCCAGTCAGTAGATAATTCCCAGGACAAACTCAGGCGGCATCACGTTCCACAGCACTG
T
AATAAGATGCCCATCACAGCAGACCTAGTGGCTCCCATCCTTAGGTTTTTGACAGAAGTTGGCAATAGT
CAT
ATCATGAAAGATTGGCTTGGTGGTTCTGAAGTCAACCCACTGTGGACAGCACTTCTGTTTTTGTTGT
GT
CACTCTGGGTCTACCGCTGGAGGACATAATTTAGGGGCACAGCAGAGCAGCACAAGGTCAGCTTCTCA
T
TCTTCAGCTACTACAACAGTCCTGACCACCCAGCAACGGACAGCCATTGAGAACGCAACTGTTGCCTTC
TTT
CTGCAGTGTATTTCATGTCACCCCAATAACCAAAAGCTGATGGCACAGGTTCTCTGTGAACTGTTTC
AG
ACAGCCCCTCAAAGGGGTAGCCTTCCAACATCTGGGAATATTTCCGGGTTTGTGCGAAGACTGTTTCT
A
CAGTTGATGCTGGAGGATGAGAAGGTGACAATGTTTCTTCAGTCACCTTGCCCACTATATAAAGGAAGA
ATT
AATGCAACTAGCCATGTCATCCAACACCCAATGTTTGGAGCAGGCCATAAGTTTCGTACTCTGCATT
TG
CCAGTCTCAACAACGTTGTCAGATGTGCTTGATAGAGTTTCAGATACACCAAGTATCACAGCTAAACT
T
ATTAGTGAGCAAAAAGATGATAAAGAAAAGAAGAACCATGAAGAGAAAGAAAAAGTTAAGGCGGAAAAT
GGA
TTTCAGGATAACTACAGCGTTGTTGTTGCCTCTGGGCTGAAATCACAGTCTAAGCGTGCCATGGCAT
CC
ACACCACCTCGCCCACCATCCAGGAGAGGAAGAACCATTCCCGATAAGATCGGAAGTGCATCCTCAAG
C
GCAGACGCGGCCAGCAAAATCATCACCGTGCCCGTGTTTCATCTGTTCCACAGACTCCTGGCAGGTCAG
CCA
CTACCAGCAGAAATGACACTTGCCCAGCTTTTAACTCTCCTCTATGACCGAAAACTTCCTCAAGGTT
AC
CGTTCAATAGATCTTACTGTTAAATTGGGATCAAAAGTCATTACAGATCCAAGTTTGTCAAAAACAGA
T
TCTTTCAAAAGACTGCACCCTGAAAAAGATCATGGAGACTTAGTTGGCAGCTGTCCAGAGGATGAGGCT
CTT
ACCCCGAGTGATGAGTGCATGGATGGAGTATTGGATGAATCTTTGCTGGAAACCTGTCCTATTCAGT
CA
CCATTACAAGTTTTTGCAGGAATGGGTGGACTGGCTCTTATTGCAGAGAGACTGCCCATGCTCTATCC
A
GAAGTGATTCAGCAGGTGAGTGCTCCAGTGATCGCTTCCACCACTCAGGAAAAGCCAAAGGATAGTGAT
CAG
TTTGAATGGGTGACCATAGAACAATCAGGTGAACTGGTTTATGAAGCTCCAGAAACCATTGCAGCTG
AG
CCTCCACCTGTTAAGTCAGCGGTGCAAGCCACGTCTCCCATACCTGCCCATTCTCTGGCTGCTTTTGG
A
TTATTTCTTCGTCTTCCGGGCTATGCTGAAGTGCTCCTGAAAGAGAGGAAGCATGCCCAGTGCCTTCTT
CGA
TTGGTGTTGGGAGTTACAGATGATGGAGAAGGCAGTCACATTCTGCAGTCTCCATCAGCCAATGTGC
TT
CCAACCCTTCCTTTCCACGTTCTTCGCAGCTTGTTTAGTGCTACTCCCTTGACAACTGATGATGGTGT
G
CTTCTGCGGCGGATGGCACTGGAGATCGGAGCTTTGCACCTAATTCTTGTCTGTCTCTCAGCTCTGAGT
CAT
CACGCACCGCGAGTTCCAAACTCTAGCCTTAGCCAAACTGAGCCGCAGGTGTCAAATTCCCATAACC
CC
ACATCAGCAGAAGAACAGCAGCTGTACTGGGCCAAAGGGACTGGCTTTGGCACAGGTTCCACGGCATC
A
GGATGGGACGTGGAACAAGCCTTAACTAAACAGAGGCTAGAAGAGGAGCATGTGACCTGCCTTTTGCAG
GTC
CTTGCGAGTTACATAAACCCCATGAGTGGTGCTGTCAATGGGGAAGCCCAGGCGTCTCCCGAGAGCC
GC
GCCCAGAACAGCAGTGCTCTGCCCTCGGTGCTTCTGGAGCTCCTCAGTCAGTCCTGCCTCATCCCAGC
C
ATGTCCTCCTACCTGCGCAACGACTCCGTTCTGGACATGGCAAGACATGTGCCACTCTATCGTGCTCTG
CTA
GAGTTGCTCCGCGCCATTGCTTCTTGCACATCTATGGTGCCGCTGTTGTTGCCTCTTTCTACAGAGA
AT
GGTGAAGAAGAGGAAGATGAACAGTCAGAATGTCAAACTTCTGTTGGTACATTATTAGCTAAAATGAA
G
ACCTGTGTCGATACCTACACCAACCGCCTAAGATCTAAAAGGGAAAATGTGAAAGCCGGAGTCAAGCCG
GAC
GCGCCTGATCAAGAGCCCGAAGGACTTGCGCTTCTGGTCCCCGACATCCAGAGGACTGCTGAGATCG
TC
CACGCCGCCACCGCCAATCTGCGGCAAGCCAATCAAGAAAAAAAACTAGGTGAATACTCAAAGAAGGT
G
GTTATGAAACCCAAACCTCTGTCAGTATTAAAATCACTTGAAGAAAAATATGTGGCTGTCATGAAAAAA
CTG
CAGTTTGATACATTTGAAATGGTTTCTGAAGATGACGATGGGAAATTGGGTTTTAAAGTAAATTACC
AC
TACATGTCTCAGGTGAAAAATGCCAACGATGCCAACAGTGCTGCCAGAGCCCGCCGCCTGGCTCAAGA
A
GCGGTGACACTGTCAACCTCACTGCCTCTGTCATCGTCTTCCAGTGTCTTTGTACGCTGTGATGAGGAG
CGA
CTTGACATCATGAAGGTTCTGATAACCGGGCCAGCGGACACCCCCTATGCAAATGGCTGCTTTGAGT
TT
GATGTATATTTTCCTCAAGATTATCCTAGCTCACCTCCTCTAGTGAACCTAGAAACAACTGGGGGTCA
T
AGTGTGCGCTTCAATCCCAACCTTTACAATGATGGCAAGGTTTGTTTAAGCATCCTGAATACATGGCAT
GGA
AGACCAGAAGAGAAGTGGAACCCTCAGACATCAAGCTTTTTGCAAGTGTTGGTTTCTGTCCAGTCCC
TT
ATATTAGTAGCTGAGCCTTACTTCAATGAACCAGGATATGAACGGTCTAGAGGCACTCCCAGTGGTAC
A
CAGAGCTCTCGAGAATACGATGGGAACATCCGACAAGCAACGGTTAAATGGGCTATGCTAGAACAAATC
AGA
AATCCTTCACCGTGCTTTAAAGAAGTTATACACAAACATTTTTACTTGAAGAGAATTGAGCTCATGG
CC
CAGTGTGAGGAGTGGATTGCAGACATCCAGCAGTACAGCAGTGACAAGCGGGTGGGCAGGACCATGTC
T
CACCATGCAGCTGCTCTCAAGCGCCACACTGCTCAGCTCCGAGAAGAGCTACTGAAACTTCCCTGCCCT
GAA
GGCTTAGATCCGGACATTGAGGATGCCTCCCCGGTGTGCAGGGCCACAGCAGGTGCTGAAGACACTC
TA
ACCCACGACCATGTCAATCCCAGCAGCAGCAAAGACCTCCCCAGTGACTTCCAATTATGA


Translation (4873 aa):
MVTGCGAAPPGTVTERLPSVIVLSAGRKMAAAAAEASGPSCSSAAAAAGAGAAGVSEWLVLRDGCMRCDA
D
GLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALS
AKPGGQVKCQYISAVDKVIFVDDYAVGCR
K
DLNGILLLDTALQTPVSKQDDVVQLELPVTE
AQQLLSACIEKIDVSSTEGYDLFITQLKDGLKNTSHET
A
ANHKVAK
WATVTFHLPHHVLKSIASAIVNELKKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRS
V
D
RALMYSEANRRETFTSWPHVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSE
H
ERHSPNCPFVKGEHTQNVPLSVTLATSPAQLPSADGADRIACFGSGSCPQFLAAATKRGKICIWDVSKL
M
KVHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGD
SDDLLEDSDSEEHSR
S
DSVT
GHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELGANPSLTNSKSEKTKEKHQ
E
QHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQGESISEQGSTDNESCTNSELNSPLVRRTL
P
VLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDNQEQLLLQDPPVTYIQQFADAAAS
L
TSPDSEKWNSVFPKPGALVQCLRLPKFAEEETLCIDSITPCADGIHLLVGLRTCSVESLSAINQVEALN
N
LNKLNSALCNRRKGDLESNLAVVNGANISVIQHESPADVPEHLLIRPEQRNVVSGGYLVLYKMNYTTRI
V
TLEEEPVKIQHIKDPQDTITSLILLPPDILDNREDDCEEPAEEMQLASKNGIEREKKSDISTLGHLVVT
T
QGGYVKVLDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTK
GGELHFLQIGGTCDDIDEA
D
ILVDGSLSKGIEPALEGSRPLSNPSSPGIS
GVELLVDQPFTLEILTSLVELTRFETLTPRFSATVPPCW
V
EVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQTD
SNSWDEHVFELVLPKACMVGHVDFKFVLNSNITS
V
PQIQVTLLKNKAPGLGKAN
ALNIEVEHNGNPSLVDLNEEMHHMDVEESQCLRLCPFLEDHKEDILCGPV
W
LASGLDLSGHAGMLTLTSPKLVK
GMAGGKYRSFLIHVKAVSDRGAADEMCSSGLRPVVRLPSLKQQGHK
G
YSLASLLAKVAAGK
EKSSNVKNENAGGTRKSENLRGCDLLQEVSVTIRRFKKTSICKERVQRCAMLQFS
E
FHEKLLNTLCRRSDDGQVTEHAQSLVLDALCWLAGVHSNGSG
SSKEGNECLLSKTRKCLSDIVRVCFFE
A
GRSIAHKCARFLALCI
SNGKCEPCQPGFGSVLLKALLDNMCFLPAAATGGSVYWYFVLLNYVKDEDLAG
C
STACAALLTAVSRQLQDRLTPLEALLQT
RYGLYSSPFDPVLFDLEMSGSSWKTVYSSSTAVQSDEIDLS
D
VLS
GNGRVSSCTAAEGSFTSLTGLLEVEPLHFTCVSTSDGTRIERDDASTFTVSSFGVPPAVGGLSSGT
V
GEASTALSSAAQVALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQ
KAKLEAKLHQTTAAAAAAASAAAA
A
AAGPVHNAVPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPP
A
VNLAAQNKNSSKSRM
NPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPILLTDVLI
P
TCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMK
ITVIGRYGSTNARAKIPLG
F
YYGHSYILPWESELKLMHDPLRGEGESASQPEIDQHLAMMVALQEDIQC
RYNLACHRLEALLQSIDLPP
L
NSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQLQLQLNLAHNAVQRLKVAIGASRKLLNETSGPEDLIQ
T
SSTEQLRTIVRYLLDTLLSLLHSSN
GHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLC
G
GERWWGQFLSNVLQELYNSEQLLIFPQD
RVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPELSMH
R
RTE
GVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQNLNRSSKGGSSLDRL
Y
SRKIRKQLVHHKQ
QLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQ