NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9977.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9977.1 Public Homo sapiens 14 AMN 20 108 85 CCDS HistoryNCBI Gene:81693Re-query CCDS DB by CCDS ID:9977.1See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9977.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000299155 ENSP00000299155 Accepted alive Link to Ensembl Transcript Viewer:ENST00000299155Link to Ensembl Protein Viewer:ENSP00000299155Re-query CCDS DB by Nucleotide ID:ENST00000299155Re-query CCDS DB by Protein ID:ENSP00000299155
Original member Current member EBI,WTSI OTTHUMT00000415704 OTTHUMP00000247078 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000415704Link to Vega Protein Viewer:OTTHUMP00000247078Re-query CCDS DB by Nucleotide ID:OTTHUMT00000415704Re-query CCDS DB by Protein ID:OTTHUMP00000247078
Original member Current member NCBI NM_030943.3 NP_112205.2 Accepted alive Link to Nucleotide Sequence:NM_030943.3Link to Protein Sequence:NP_112205.2Re-query CCDS DB by Nucleotide ID:NM_030943Re-query CCDS DB by Protein ID:NP_112205Link to BLink:NP_112205.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_112205.2 453 Q9BXJ7-1 453 100% 0 0

Chromosomal Locations for CCDS 9977.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 102922689 102922731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102923711 102923829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102923935 102923979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102928426 102928513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102928758 102928975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102929121 102929258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102929428 102929536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102929655 102929737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102929924 102930086 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102930165 102930327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102930406 102930493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 102930576 102930680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1362 nt):
ATGGGCGTCCTGGGCCGGGTCCTGCTGTGGCTGCAGCTCTGCGCACTGACCCAGGCGGTCTCCAAACTCT
GG
GTCCCCAACACGGACTTCGACGTCGCAGCCAACTGGAGCCAGAACCGGACCCCGTGCGCCGGCGGCGC
C
GTTGAGTTCCCGGCGGACAAGATGGTGTCAGTCCTGGTGCAAGAAGGTCACGCCGTCTCAGACATGCTC
CTG
CCGCTGGATGGGGAACTCGTCCTGGCTTCAGGAGCCGGATTCGGCGTCTCAGACGTGGGCTCGCACC
TG
GACTGTGGCGCGGGCGAACCTGCCGTCTTCCGCGACTCTGACCGCTTCTCCTGGCATGACCCGCACCT
G
TGGCGCTCTGGGGACGAGGCACCTGGCCTCTTCTTCGTGGACGCCGAGCGCGTGCCCTGCCGCCACGAC
GAC
GTCTTCTTTCCGCCTAGTGCCTCCTTCCGCGTGGGGCTCGGCCCTGGCGCTAGCCCCGTGCGTGTCC
GC
AGCATCTCGGCTCTGGGCCGGACGTTCACGCGCGACGAGGACCTGGCTGTTTTCCTGGCGTCCCGCGC
G
GGCCGCCTACGCTTCCACGGGCCGGGCGCGCTGAGCGTGGGCCCCGAGGACTGCGCGGACCCGTCGGGC
TGC
GTCTGCGGCAACGCGGAGGCGCAGCCGTGGATCTGCGCGGCCCTGCTCCAGCCCCTGGGCGGCCGCT
GC
CCCCAGGCCGCCTGCCACAGCGCCCTCCGGCCCCAGGGGCAGTGCTGTGACCTCTGTGGAGCCGTTGT
G
TTGCTGACCCACGGCCCCGCATTTGACCTGGAGCGGTACCGGGCGCGGATACTGGACACCTTCCTGGGT
CTG
CCTCAGTACCACGGGCTGCAGGTGGCCGTGTCCAAGGTGCCACGCTCGTCCCGGCTCCGTGAGGCCG
AT
ACGGAGATCCAGGTGGTGCTGGTGGAGAATGGGCCCGAGACAGGCGGAGCGGGGCGGCTGGCCCGGGC
C
CTCCTGGCGGACGTCGCCGAGAACGGCGAGGCCCTCGGCGTCCTGGAGGCGACCATGCGGGAGTCGGGC
GCA
CACGTCTGGGGCAGCTCCGCGGCTGGGCTGGCGGGCGGCGTGGCGGCTGCCGTGCTGCTGGCGCTGC
TG
GTCCTGCTGGTGGCGCCGCCGCTGCTGCGCCGCGCGGGGAGGCTCAGGTGGAGGAGGCACGAGGCGGC
G
GCCCCGGCTGGAGCGCCCCTCGGCTTCCGCAACCCGGTGTTCGACGTGACGGCCTCCGAGGAGCTGCCC
CTG
CCGCGGCGGCTCAGCCTGGTTCCGAAGGCGGCCGCAGACAGCACCAGCCACAGTTACTTCGTCAACC
CT
CTGTTCGCCGGGGCCGAGGCCGAGGCCTGA


Translation (453 aa):
MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDML
L
PLDGELVLASGAGFGVSDVGSHLDCGA
GEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHD
D
VFFPPSASFRVGLGPGASPVRVRSISALGR
TFTRDEDLAVFLASRAGRLRFHGPGALSVGPEDCADPSG
C
VCGNAE
AQPWICAALLQPLGGRCPQAACHSALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLG
L
PQYHGLQVAVSKVPRSSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG
A
HVWGSSAAGLAGGVAAAVLLALLVLLVAPPLLRRAGRL
RWRRHEAAAPAGAPLGFRNPVFDVTASEELP
L
PRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser