NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2618.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2618.1 Public Homo sapiens 3 TMEM43 20 108 85 CCDS HistoryNCBI Gene:79188Re-query CCDS DB by CCDS ID:2618.1See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2618.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000306077 ENSP00000303992 Accepted alive Link to Ensembl Transcript Viewer:ENST00000306077Link to Ensembl Protein Viewer:ENSP00000303992Re-query CCDS DB by Nucleotide ID:ENST00000306077Re-query CCDS DB by Protein ID:ENSP00000303992
Original member Current member EBI,WTSI OTTHUMT00000252030 OTTHUMP00000160233 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000252030Link to Vega Protein Viewer:OTTHUMP00000160233Re-query CCDS DB by Nucleotide ID:OTTHUMT00000252030Re-query CCDS DB by Protein ID:OTTHUMP00000160233
Original member Current member NCBI NM_024334.2 NP_077310.1 Accepted alive Link to Nucleotide Sequence:NM_024334.2Link to Protein Sequence:NP_077310.1Re-query CCDS DB by Nucleotide ID:NM_024334Re-query CCDS DB by Protein ID:NP_077310Link to BLink:NP_077310.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077310.1 400 Q9BTV4 400 100% 0 0

Chromosomal Locations for CCDS 2618.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 14125194 14125205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14129412 14129561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14130822 14130956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14131580 14131674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14132546 14132595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14132866 14132935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14133739 14133809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14134770 14134891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14135158 14135232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14135807 14135908 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14139180 14139297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 14141593 14141795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1203 nt):
ATGGCCGCGAATTATTCCAGTACCAGTACCCGGAGAGAACATGTCAAAGTTAAAACCAGCTCCCAGCCAG
GC
TTCCTGGAACGGCTGAGCGAGACCTCGGGTGGGATGTTTGTGGGGCTCATGGCCTTCCTGCTCTCCTT
C
TACCTAATTTTCACCAATGAGGGCCGCGCATTGAAGACGGCAACCTCATTGGCTGAGGGGCTCTCGCTT
GTG
GTGTCTCCCGACAGCATCCACAGTGTGGCTCCGGAGAATGAAGGAAGGCTGGTGCACATCATTGGCG
CC
TTACGGACATCCAAGCTTTTGTCTGATCCAAACTATGGGGTCCATCTTCCGGCTGTGAAACTGCGGAG
G
CACGTGGAGATGTACCAATGGGTAGAAACTGAGGAGTCCAGGGAGTACACCGAGGATGGGCAGGTGAAG
AAG
GAGACGAGGTATTCCTACAACACTGAATGGAGGTCAGAAATCATCAACAGCAAAAACTTCGACCGAG
AG
ATTGGCCACAAAAACCCCAGTGCCATGGCAGTGGAGTCATTCATGGCAACAGCCCCCTTTGTCCAAAT
T
GGCAGGTTTTTCCTCTCGTCAGGCCTCATCGACAAAGTCGACAACTTCAAGTCCCTGAGCCTATCCAAG
CTG
GAGGACCCTCATGTGGACATCATTCGCCGTGGAGACTTTTTCTACCACAGCGAAAATCCCAAGTATC
CA
GAGGTGGGAGACTTGCGTGTCTCCTTTTCCTATGCTGGACTGAGCGGCGATGACCCTGACCTGGGCCC
A
GCTCACGTGGTCACTGTGATTGCCCGGCAGCGGGGTGACCAGCTAGTCCCATTCTCCACCAAGTCTGGG
GAT
ACCTTACTGCTCCTGCACCACGGGGACTTCTCAGCAGAGGAGGTGTTTCATAGAGAACTAAGGAGCA
AC
TCCATGAAGACCTGGGGCCTGCGGGCAGCTGGCTGGATGGCCATGTTCATGGGCCTCAACCTTATGAC
A
CGGATCCTCTACACCTTGGTGGACTGGTTTCCTGTTTTCCGAGACCTGGTCAACATTGGCCTGAAAGCC
TTT
GCCTTCTGTGTGGCCACCTCGCTGACCCTGCTGACCGTGGCGGCTGGCTGGCTCTTCTACCGACCCC
TG
TGGGCCCTCCTCATTGCCGGCCTGGCCCTTGTGCCCATCCTTGTTGCTCGGACACGGGTGCCAGCCAA
A
AAGTTGGAGTGA


Translation (400 aa):
MAANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKTATSLAEGLSL
V
VSPDSIHSVAPENEGRLVHIIGALRTSK
LLSDPNYGVHLPAVKLRRHVEMYQWVETEESREYTEDGQVK
K
ETRYSY
NTEWRSEIINSKNFDREIGHKNPSAMAVESFMATAPFVQIGRFFLSSGLIDKVDNFKSLSLSK
L
EDPHVDIIRRGDFFYHSENPKYPE
VGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSG
D
TLLLLHHGDFSAE
EVFHRELRSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKA
F
AFCVATSLTLLTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser