NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 18, 2019, starting at 8:15 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS295.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
295.1 Public Homo sapiens 1 SLC9A1 22 109 92 CCDS HistoryNCBI Gene:6548Re-query CCDS DB by CCDS ID:295.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 295.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000263980.7 ENSP00000263980.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000263980.7Link to Ensembl Protein Viewer:ENSP00000263980.3Re-query CCDS DB by Nucleotide ID:ENST00000263980Re-query CCDS DB by Protein ID:ENSP00000263980
Original member NCBI NM_003047.4 NP_003038.2 Updated not alive Link to Nucleotide Sequence:NM_003047.4Link to Protein Sequence:NP_003038.2Re-query CCDS DB by Nucleotide ID:NM_003047Re-query CCDS DB by Protein ID:NP_003038
Current member NCBI NM_003047.5 NP_003038.2 Accepted alive Link to Nucleotide Sequence:NM_003047.5Link to Protein Sequence:NP_003038.2Re-query CCDS DB by Nucleotide ID:NM_003047Re-query CCDS DB by Protein ID:NP_003038Link to BLAST:NP_003038.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003038.2 815 P19634-1 815 100% 0 0

Chromosomal Locations for CCDS 295.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 27100307 27100644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27101203 27101275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27101725 27101826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27102016 27102130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27102385 27102558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27102673 27102743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27103223 27103312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27105885 27106087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27107648 27107865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27109527 27109777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27113826 27114286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 27153983 27154334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2448 nt):
ATGGTTCTGCGGTCTGGCATCTGTGGCCTCTCTCCACATCGGATCTTCCCTTCCTTACTCGTGGTGGTTG
CT
TTGGTGGGGCTGCTGCCTGTTCTCAGGAGCCATGGCCTCCAGCTCAGCCCAACTGCCAGCACCATTCG
A
AGCTCAGAGCCACCACGAGAACGCTCGATTGGGGATGTCACCACCGCTCCACCGGAGGTCACCCCAGAG
AGC
CGCCCTGTTAATCATTCCGTCACTGATCATGGCATGAAGCCGCGCAAGGCCTTTCCAGTCCTGGGCA
TC
GACTACACACACGTGCGCACCCCCTTCGAGATCTCCCTCTGGATCCTTCTGGCCTGCCTCATGAAGAT
A
GGTTTCCATGTGATCCCCACTATCTCAAGCATCGTCCCGGAGAGCTGCCTGCTGATCGTGGTGGGGCTG
CTG
GTGGGGGGCCTGATCAAGGGTGTAGGCGAGACACCCCCCTTCCTGCAGTCCGACGTCTTCTTCCTCT
TC
CTGCTGCCGCCCATCATCCTGGATGCGGGCTACTTCCTGCCACTGCGGCAGTTCACAGAAAACCTGGG
C
ACCATCCTGATCTTTGCCGTGGTGGGCACGCTGTGGAACGCCTTCTTCCTGGGCGGCCTCATGTACGCC
GTG
TGCCTGGTGGGCGGTGAGCAGATCAACAACATCGGCCTCCTGGACAACCTGCTCTTCGGCAGCATCA
TC
TCGGCCGTGGACCCCGTGGCGGTTCTGGCTGTCTTTGAGGAAATTCACATCAATGAGCTGCTGCACAT
C
CTTGTTTTTGGGGAGTCCTTGCTCAATGACGCCGTCACTGTGGTCCTGTATCACCTCTTTGAGGAGTTT
GCC
AACTACGAACACGTGGGCATCGTGGACATCTTCCTCGGCTTCCTGAGCTTCTTCGTGGTGGCCCTGG
GC
GGGGTGCTTGTGGGCGTGGTCTACGGGGTCATCGCAGCCTTCACCTCCCGATTTACCTCCCACATCCG
G
GTCATCGAGCCGCTCTTCGTCTTCCTCTACAGCTACATGGCCTACTTGTCAGCCGAGCTCTTCCACCTG
TCA
GGCATCATGGCGCTCATAGCCTCAGGAGTGGTGATGCGCCCCTATGTGGAGGCCAACATCTCCCACA
AG
TCCCACACCACCATCAAATACTTCCTGAAGATGTGGAGCAGCGTCAGCGAGACCCTCATCTTCATCTT
C
CTCGGCGTCTCCACGGTGGCCGGCTCCCACCACTGGAACTGGACCTTCGTCATCAGCACCCTGCTCTTC
TGC
CTCATCGCCCGCGTGCTGGGGGTGCTGGGCCTGACCTGGTTCATCAACAAGTTCCGTATCGTGAAGC
TG
ACCCCCAAGGACCAGTTCATCATCGCCTATGGGGGCCTGCGAGGGGCCATCGCCTTCTCTCTGGGCTA
C
CTCCTGGACAAGAAGCACTTCCCCATGTGTGACCTGTTCCTCACTGCCATCATCACTGTCATCTTCTTC
ACC
GTCTTTGTGCAGGGCATGACCATTCGGCCCCTGGTAGACCTGTTGGCTGTGAAGAAAAAGCAAGAGA
CG
AAGCGCTCCATCAACGAAGAGATCCACACACAGTTCCTGGACCACCTTCTGACAGGCATCGAAGACAT
C
TGTGGCCACTACGGTCACCACCACTGGAAGGACAAGCTCAACCGGTTTAATAAGAAATATGTGAAGAAG
TGT
CTGATAGCTGGCGAGCGCTCCAAGGAGCCCCAGCTCATTGCCTTCTACCACAAGATGGAGATGAAGC
AG
GCCATCGAGCTGGTGGAGAGCGGGGGCATGGGCAAGATCCCCTCTGCCGTCTCCACCGTCTCCATGCA
G
AACATCCACCCCAAGTCCCTGCCTTCCGAGCGCATCCTGCCAGCACTGTCCAAGGACAAGGAGGAGGAG
ATC
CGCAAAATCCTGAGGAACAACTTGCAGAAGACCAGGCAGCGGCTGCGGTCCTACAACAGACACACGC
TG
GTGGCAGACCCCTACGAGGAAGCCTGGAACCAGATGCTGCTCCGGAGGCAGAAGGCCCGGCAGCTGGA
G
CAGAAGATCAACAACTACCTGACGGTGCCAGCCCACAAGCTGGACTCACCCACCATGTCTCGGGCCCGC
ATC
GGCTCAGACCCACTGGCCTATGAGCCGAAGGAGGACCTGCCTGTCATCACCATCGACCCGGCTTCCC
CG
CAGTCACCCGAGTCTGTGGACCTGGTGAATGAAGAGCTGAAGGGCAAAGTCTTAGGGTTGAGCCGGGA
T
CCTGCAAAGGTGGCTGAGGAGGACGAGGACGACGATGGGGGCATCATGATGCGGAGCAAGGAGACTTCG
TCC
CCAGGAACCGACGATGTCTTCACCCCCGCGCCCAGTGACAGCCCCAGCTCCCAGAGGATACAGCGCT
GC
CTCAGTGACCCAGGCCCACACCCTGAGCCTGGGGAGGGAGAACCGTTCTTCCCCAAGGGGCAGTAA


Translation (815 aa):
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPE
S
RPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKI
GFHVIPTISSIVPESCLLIVVGL
L
VGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYA
V
CLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTV
VLYHLFEEF
A
NYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHL
S
GIM
ALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
C
LIARVL
GVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFF
T
VFVQ
GMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKK
C
LIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVSTVSM
QNIHPKSLPSERILPALSKDKEEE
I
RKILRNNLQKTRQR
LRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRAR
I
GS
DPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETS
S
PGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser