NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS33938.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33938.1 Public Homo sapiens 4 UVSSA 20 108 85 CCDS HistoryNCBI Gene:57654Re-query CCDS DB by CCDS ID:33938.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33938.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000389851 ENSP00000374501 Accepted alive Link to Ensembl Transcript Viewer:ENST00000389851Link to Ensembl Protein Viewer:ENSP00000374501Re-query CCDS DB by Nucleotide ID:ENST00000389851Re-query CCDS DB by Protein ID:ENSP00000374501
Original member Current member EBI,WTSI ENST00000507531 ENSP00000421741 Accepted alive Link to Ensembl Transcript Viewer:ENST00000507531Link to Ensembl Protein Viewer:ENSP00000421741Re-query CCDS DB by Nucleotide ID:ENST00000507531Re-query CCDS DB by Protein ID:ENSP00000421741
Original member Current member EBI,WTSI ENST00000511216 ENSP00000425130 Accepted alive Link to Ensembl Transcript Viewer:ENST00000511216Link to Ensembl Protein Viewer:ENSP00000425130Re-query CCDS DB by Nucleotide ID:ENST00000511216Re-query CCDS DB by Protein ID:ENSP00000425130
Original member Current member EBI,WTSI OTTHUMT00000359480 OTTHUMP00000217693 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000359480Link to Vega Protein Viewer:OTTHUMP00000217693Re-query CCDS DB by Nucleotide ID:OTTHUMT00000359480Re-query CCDS DB by Protein ID:OTTHUMP00000217693
Original member Current member EBI,WTSI OTTHUMT00000359481 OTTHUMP00000217694 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000359481Link to Vega Protein Viewer:OTTHUMP00000217694Re-query CCDS DB by Nucleotide ID:OTTHUMT00000359481Re-query CCDS DB by Protein ID:OTTHUMP00000217694
Original member Current member EBI,WTSI OTTHUMT00000359482 OTTHUMP00000217695 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000359482Link to Vega Protein Viewer:OTTHUMP00000217695Re-query CCDS DB by Nucleotide ID:OTTHUMT00000359482Re-query CCDS DB by Protein ID:OTTHUMP00000217695
Original member Current member NCBI NM_001317934.1 NP_001304863.1 Accepted alive Link to Nucleotide Sequence:NM_001317934.1Link to Protein Sequence:NP_001304863.1Re-query CCDS DB by Nucleotide ID:NM_001317934Re-query CCDS DB by Protein ID:NP_001304863Link to BLink:NP_001304863.1
Original member Current member NCBI NM_001317935.1 NP_001304864.1 Accepted alive Link to Nucleotide Sequence:NM_001317935.1Link to Protein Sequence:NP_001304864.1Re-query CCDS DB by Nucleotide ID:NM_001317935Re-query CCDS DB by Protein ID:NP_001304864Link to BLink:NP_001304864.1
Original member Current member NCBI NM_020894.3 NP_065945.2 Accepted alive Link to Nucleotide Sequence:NM_020894.3Link to Protein Sequence:NP_065945.2Re-query CCDS DB by Nucleotide ID:NM_020894Re-query CCDS DB by Protein ID:NP_065945Link to BLink:NP_065945.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001304863.1 709 Q2YD98-1 709 100% 0 0
NP_001304864.1 709 Q2YD98-1 709 100% 0 0
NP_065945.2 709 Q2YD98-1 709 100% 0 0

Chromosomal Locations for CCDS 33938.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 1348092 1348189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1349524 1349854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1351715 1351835 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1353030 1353413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1354735 1354847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1355117 1355245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1366320 1366431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1375364 1375508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1376034 1376168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1380047 1380230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1380880 1380988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1383766 1383940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 1385868 1385961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2130 nt):
ATGGATCAGAAACTTTCGAAGTTGGTAGAAGAGCTCACAACTTCAGGAGAACCCCGACTAAATCCTGAGA
AA
ATGAAGGAACTGAAGAAAATTTGCAAGTCTTCAGAGGAGCAGCTGAGCCGCGCCTACCGCCTGCTGAT
A
GCACAGCTGACCCAGGAGCACGCCGAGATCCGTCTCTCAGCCTTCCAGATTGTGGAGGAACTCTTCGTC
AGG
TCTCACCAGTTCCGGATGCTGGTTGTTTCCAACTTCCAGGAGTTCCTGGAGCTCACGCTGGGCACAG
AC
CCCGCACAGCCTCTGCCGCCCCCCAGGGAGGCGGCACAGAGGCTGAGGCAGGCGACCACCCGGGCCGT
G
GAAGGGTGGAATGAGAAGTTTGGGGAGGCCTACAAGAAGCTTGCCTTGGGCTACCACTTCTTAAGACAC
AAC
AAAAAGGTGGATTTTCAAGACACGAATGCTCGGAGTCTGGCAGAAAGGAAGAGAGAAGAGGAGAAGC
AG
AAGCACTTGGATAAAATTTATCAAGAAAGAGCCAGCCAGGCGGAGAGGGAGATGCAAGAAATGTCTGG
A
GAAATTGAATCCTGCTTGACGGAGGTAGAGAGCTGCTTTAGGCTGCTGGTGCCTTTTGACTTTGACCCG
AAC
CCGGAGACGGAATCCCTTGGCATGGCTTCTGGCATGTCCGATGCCCTTCGCTCCTCCTGCGCGGGCC
AG
GTGGGCCCCTGCCGGTCTGGCACCCCTGACCCCCGGGACGGGGAGCAGCCCTGCTGCAGTAGAGACCT
G
CCTGCCTCTGCAGGCCACCCCAGAGCGGGCGGCGGGGCACAGCCATCCCAGACAGCCACAGGTGACCCC
TCA
GATGAGGACGAGGACAGCGACCTCGAGGAGTTTGTGCGGAGCCACGGGCTGGGCTCGCACAAGTACA
CG
CTGGATGTGGAGCTCTGCTCAGAGGGCCTGAAGGTGCAGGAGAACGAGGACAACCTTGCTCTCATCCA
C
GCCGCCCGCGACACACTCAAGCTCATCCGGAACAAGTTCCTGCCGGCTGTGTGCTCGTGGATCCAGCGC
TTC
ACCCGCGTCGGGACCCACGGTGGATGTTTAAAGCGTGCCATTGACCTGAAGGCTGAATTGGAGCTCG
TA
CTGAGAAAATACAAGGAGCTGGACATCGAGCCTGAGGGAGGGGAAAGGCGCAGGACAGAAGCCCTGGG
G
GATGCGGAGGAAGATGAGGACGATGAGGACTTTGTGGAGGTCCCTGAGAAGGAGGGGTATGAGCCACAC
ATC
CCCGACCACTTGCGGCCTGAGTATGGGCTGGAGGCAGCACCAGAGAAAGACACAGTTGTGCGGTGCT
TG
CGGACGAGGACGAGGATGGACGAGGAGGTGTCGGACCCCACCTCTGCGGCTGCTCAGCTGCGGCAGCT
C
CGGGACCACTTGCCTCCACCCTCATCTGCCAGCCCCTCCAGAGCGTTGCCAGAGCCACAGGAGGCCCAG
AAG
CTGGCAGCAGAGCGGGCCCGGGCGCCTGTGGTGCCCTACGGCGTGGACCTGCACTACTGGGGCCAGG
AG
CTCCCCACAGCCGGGAAGATTGTCAAGTCTGACTCCCAGCACCGCTTCTGGAAGCCCAGCGAGGTGGA
G
GAGGAAGTGGTCAATGCCGACATCTCCGAGATGCTCCGGAGCCGCCACATCACTTTTGCCGGGAAGTTT
GAG
CCTGTGCAGCACTGGTGCCGTGCCCCGAGGCCAGACGGCCGGCTCTGTGAGCGCCAAGACCGGCTGA
AG
TGCCCTTTCCATGGGAAGATTGTTCCACGGGACGACGAAGGACGGCCGCTCGACCCGGAAGACAGGGC
T
CGTGAGCAGCGGCGGCAGCTGCAGAAGCAGGAGCGCCCGGAATGGCAGGACCCTGAGTTGATGAGAGAC
GTG
GAAGCAGCCACAGGGCAGGATCTCGGCTCATCCAGGTACAGCGGGAAAGGCAGGGGGAAGAAGAGGA
GG
TACCCCAGCCTCACCAACCTGAAGGCTCAGGCTGATACCGCCCGCGCTCGCATTGGGAGAAAAGTCTT
C
GCCAAGGCAGCTGTGCGGAGGGTAGTGGCAGCCATGAACCGGATGGACCAGAAGAAGCACGAGAAGTTT
TCA
AACCAGTTTAACTACGCACTGAACTAG


Translation (709 aa):
MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLSAFQIVEELFV
R
SHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGWNEKFGEAYKKLALGYHFLRH
N
KK
VDFQDTNARSLAERKREEEKQKHLDKIYQERASQAEREMQEMSGEIESCLTEVESCFRLLVPFDFDP
N
PETESLGMASGMSDALRSSCAGQVGPCRSGTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDP
S
DEDEDSDLEEFVRSHGLGSHKYTLDVELCS
EGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQR
F
TRVGTHGGCLKRAIDLKAELELVLRKYKELDIEPEGGERRR
TEALGDAEEDEDDEDFVEVPEKEGYEPH
I
PDHLRPEY
GLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQ
K
LAAERARAPVVPYGVDLHYWGQELPTAGKIV
KSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKF
E
PVQHWCRAPRPDGRLCERQDRLK
CPFHGKIVPRDDEGRPLDPEDRAREQRRQLQKQERPEWQDPELMRD
V
EAATGQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFA
KAAVRRVVAAMNRMDQKKHEKF
S
NQFNYALN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser