NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12039.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12039.1 Public Homo sapiens 19 RNF126 20 108 85 CCDS HistoryNCBI Gene:55658Re-query CCDS DB by CCDS ID:12039.1See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12039.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000292363 ENSP00000292363 Accepted alive Link to Ensembl Transcript Viewer:ENST00000292363Link to Ensembl Protein Viewer:ENSP00000292363Re-query CCDS DB by Nucleotide ID:ENST00000292363Re-query CCDS DB by Protein ID:ENSP00000292363
Original member Current member EBI,WTSI OTTHUMT00000452104 OTTHUMP00000264743 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000452104Link to Vega Protein Viewer:OTTHUMP00000264743Re-query CCDS DB by Nucleotide ID:OTTHUMT00000452104Re-query CCDS DB by Protein ID:OTTHUMP00000264743
Original member Current member NCBI NM_194460.2 NP_919442.1 Accepted alive Link to Nucleotide Sequence:NM_194460.2Link to Protein Sequence:NP_919442.1Re-query CCDS DB by Nucleotide ID:NM_194460Re-query CCDS DB by Protein ID:NP_919442Link to BLAST:NP_919442.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_919442.1 311 Q9BV68-2 311 100% 0 0

Chromosomal Locations for CCDS 12039.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 648128 648277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 648372 648487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 648882 648975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 649679 649748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 650234 650296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 651611 651855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 652233 652296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 652826 652884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 663047 663121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGGCCGAGGCGTCGCCGCATCCCGGACGGTACTTCTGCCACTGCTGCTCCGTGGAGATCGTCCCGCGCC
TG
CCGGATTATATCTGTCCAAGATGCGAGTCTGGTTTTATCGAGGAGCTTCCGGAAGAGACCAGGAGCAC
A
GAAAATGGTTCTGCCCCCTCCACAGCTCCCACAGACCAGAGCCGGCCACCGTTGGAGCACGTGGACCAG
CAC
CTGTTCACGCTGCCGCAGGGCTACGGACAGTTTGCTTTCGGCATCTTCGATGACAGCTTCGAGATCC
CC
ACGTTCCCTCCTGGGGCGCAGGCTGACGACGGCAGGGACCCTGAGAGCCGGCGGGAGAGAGACCATCC
G
TCCCGGCACCGGTACGGCGCCCGACAGCCCCGCGCCCGCCTCACCACGCGGCGGGCCACCGGCCGGCAC
GAA
GGCGTCCCCACGCTGGAAGGGATCATCCAGCAGCTCGTCAACGGCATCATCACGCCCGCCACCATCC
CC
AGCCTGGGCCCCTGGGGAGTCCTGCACTCAAACCCTATGGACTACGCCTGGGGGGCCAACGGCCTGGA
T
GCCATCATCACACAGCTCCTCAATCAGTTTGAAAACACAGGCCCCCCACCGGCAGATAAAGAGAAAATC
CAG
GCCCTCCCCACCGTCCCCGTCACTGAGGAGCACGTAGGCTCCGGGCTCGAGTGCCCTGTGTGCAAGG
AC
GACTACGCGCTGGGTGAGCGTGTGCGGCAGCTGCCCTGCAACCACCTGTTCCACGACGGCTGCATCGT
G
CCCTGGCTGGAGCAGCACGACAGCTGCCCCGTCTGCCGAAAAAGCCTCACGGGACAGAACACGGCCACG
AAC
CCCCCTGGCCTCACTGGGGTGAGCTTCTCCTCCTCGTCGTCATCGTCCTCCTCCAGCTCGCCCAGCA
AC
GAGAACGCCACAAGCAACTCGTGA


Translation (311 aa):
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQ
H
LFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHRYGARQPRARLTTRRATGRH
E
GVPTLE
GIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKI
Q
ALPTVPVTEEHV
GSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTAT
N
PPGLTGVSFSSSSSSSSSSSPSNENATSNS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser