NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1752.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1752.1 Public Homo sapiens 2 PPM1G 20 108 85 CCDS HistoryNCBI Gene:5496Re-query CCDS DB by CCDS ID:1752.1See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1752.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000344034 ENSP00000342778 Accepted alive Link to Ensembl Transcript Viewer:ENST00000344034Link to Ensembl Protein Viewer:ENSP00000342778Re-query CCDS DB by Nucleotide ID:ENST00000344034Re-query CCDS DB by Protein ID:ENSP00000342778
Original member Current member EBI,WTSI OTTHUMT00000215032 OTTHUMP00000123426 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000215032Link to Vega Protein Viewer:OTTHUMP00000123426Re-query CCDS DB by Nucleotide ID:OTTHUMT00000215032Re-query CCDS DB by Protein ID:OTTHUMP00000123426
Original member Current member NCBI NM_177983.2 NP_817092.1 Accepted alive Link to Nucleotide Sequence:NM_177983.2Link to Protein Sequence:NP_817092.1Re-query CCDS DB by Nucleotide ID:NM_177983Re-query CCDS DB by Protein ID:NP_817092Link to BLAST:NP_817092.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_817092.1 546 O15355 546 100% 0 0

Chromosomal Locations for CCDS 1752.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 27381599 27381805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27382126 27382228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27382476 27382605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27383366 27383600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27383952 27384092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27384673 27385088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27385747 27385879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27386194 27386279 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27387089 27387158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 27409303 27409422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1641 nt):
ATGGGTGCCTACCTCTCCCAGCCCAACACGGTGAAGTGCTCCGGGGACGGGGTCGGCGCCCCGCGCCTGC
CG
CTGCCCTACGGCTTCTCCGCCATGCAAGGCTGGCGCGTCTCCATGGAGGATGCTCACAACTGTATTCC
T
GAGCTGGACAGTGAGACAGCCATGTTTTCTGTCTACGATGGACATGGAGGGGAGGAAGTTGCCTTGTAC
TGT
GCCAAATATCTTCCTGATATCATCAAAGATCAGAAGGCCTACAAGGAAGGCAAGCTACAGAAGGCTT
TA
GAAGATGCCTTCTTGGCTATTGACGCCAAATTGACCACTGAAGAAGTCATTAAAGAGCTGGCACAGAT
T
GCAGGGCGACCCACTGAGGATGAAGATGAAAAAGAAAAAGTAGCTGATGAAGATGATGTGGACAATGAG
GAG
GCTGCACTGCTGCATGAAGAGGCTACCATGACTATTGAAGAGCTGCTGACACGCTACGGGCAGAACT
GT
CACAAGGGCCCTCCCCACAGCAAATCTGGAGGTGGGACAGGCGAGGAACCAGGGTCCCAGGGCCTCAA
T
GGGGAGGCAGGACCTGAGGACTCAACTAGGGAAACTCCTTCACAAGAAAATGGCCCCACAGCCAAGGCC
TAC
ACAGGCTTTTCCTCCAACTCGGAACGTGGGACTGAGGCAGGCCAAGTTGGTGAGCCTGGCATTCCCA
CT
GGTGAGGCTGGGCCTTCCTGCTCTTCAGCCTCTGACAAGCTGCCTCGAGTTGCTAAGTCCAAGTTCTT
T
GAGGACAGTGAGGATGAGTCAGATGAGGCGGAGGAAGAAGAGGAAGACAGTGAGGAATGCAGCGAGGAA
GAG
GATGGCTACAGCAGTGAGGAGGCAGAGAATGAGGAAGATGAGGATGACACCGAGGAGGCTGAAGAGG
AC
GATGAAGAAGAAGAAGAAGAGATGATGGTGCCAGGGATGGAAGGCAAAGAGGAGCCTGGCTCTGACAG
T
GGTACAACAGCGGTGGTGGCCCTGATACGAGGGAAGCAGTTGATTGTAGCCAACGCAGGAGACTCTCGC
TGT
GTGGTATCTGAGGCTGGCAAAGCTTTAGACATGTCCTATGATCACAAACCAGAGGATGAAGTAGAAC
TA
GCACGCATCAAGAATGCTGGTGGCAAGGTCACCATGGATGGGCGAGTCAACGGGGGCCTCAACCTCTC
C
AGAGCCATTGGGGACCACTTCTATAAGAGAAACAAGAACCTGCCACCTGAGGAACAGATGATTTCAGCC
CTT
CCTGACATCAAGGTGCTGACTCTCACTGACGACCATGAATTCATGGTCATTGCCTGTGATGGCATCT
G
G
AATGTGATGAGCAGCCAGGAAGTTGTAGATTTCATTCAATCAAAGATCAGCCAGCGTGATGAAAATGG
G
GAGCTTCGGTTATTGTCATCCATTGTGGAAGAGCTGCTGGATCAGTGCCTGGCACCAGACACTTCTGGG
GAT
GGTACAGGGTGTGACAACATGACCTGCATCATCATTTGCTTCAAGCCCCGAAACACAGCAGAGCTCC
AG
CCAGAGAGTGGCAAGCGAAAACTAGAGGAGGTGCTCTCTACTGAGGGGGCTGAAGAAAATGGCAACAG
C
GACAAGAAGAAGAAGGCCAAGCGAGACTAG


Translation (546 aa):
MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY
C
AKYLPDIIKDQKAYKEGKLQK
ALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE
E
AALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA
Y
TGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSE
ECSEE
E
DGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEE
PGSDSGTTAVVALIRGKQLIVANAGDSR
C
VVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAI
GDHFYKRNKNLPPEEQMISA
L
PDIKVLTLTDDHEFMVIACDGI
WNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG
D
GTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser