NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, January 22, 2020, starting at 8:00 a.m. EST for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS48174.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48174.1 Public Homo sapiens X CT45A1 22 109 92 CCDS HistoryNCBI Gene:541466Re-query CCDS DB by CCDS ID:48174.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48174.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000594117.4 ENSP00000470185.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000594117.4Link to Ensembl Protein Viewer:ENSP00000470185.2Re-query CCDS DB by Nucleotide ID:ENST00000594117Re-query CCDS DB by Protein ID:ENSP00000470185
Original member Current member EBI,WTSI ENST00000594565.5 ENSP00000472303.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000594565.5Link to Ensembl Protein Viewer:ENSP00000472303.1Re-query CCDS DB by Nucleotide ID:ENST00000594565Re-query CCDS DB by Protein ID:ENSP00000472303
Original member Current member NCBI NM_001017417.2 NP_001017417.1 Accepted alive Link to Nucleotide Sequence:NM_001017417.2Link to Protein Sequence:NP_001017417.1Re-query CCDS DB by Nucleotide ID:NM_001017417Re-query CCDS DB by Protein ID:NP_001017417Link to BLAST:NP_001017417.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001017417.1 189 Q5HYN5 189 100% 0 0

Chromosomal Locations for CCDS 48174.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 135718941 135719109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 135721028 135721276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 135721658 135721751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 135722976 135723033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (570 nt):
ATGACCGATAAAACAGAGAAGGTGGCTGTAGATCCTGAAACTGTGTTTAAACGTCCCAGGGAATGTGACA
GT
CCTTCGTATCAGAAAAGGCAGAGGATGGCCCTGTTGGCAAGGAAACAAGGAGCAGGAGACAGCCTTAT
T
GCAGGCTCTGCCATGTCCAAAGCAAAGAAGCTTATGACAGGACATGCTATTCCACCCAGCCAATTGGAT
TCT
CAGATTGATGACTTCACTGGTTTCAGCAAAGATAGGATGATGCAGAAACCTGGTAGCAATGCACCTG
TG
GGAGGAAACGTTACCAGCAGTTTCTCTGGAGATGACCTAGAATGCAGAGAAACAGCCTCCTCTCCCAA
A
AGCCAACGAGAAATTAATGCTGATATAAAACGTAAATTAGTGAAGGAACTCCGATGCGTTGGACAAAAA
TAT
GAAAAAATCTTCGAAATGCTTGAAGGAGTGCAAGGACCTACTGCAGTCAGGAAGCGATTTTTTGAAT
CC
ATCATCAAGGAAGCAGCAAGATGTATGAGACGAGACTTTGTTAAGCACCTTAAGAAGAAACTGAAACG
T
ATGATTTGA


Translation (189 aa):
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLD
S
QIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQ
K
Y
EKIFEMLEGVQGPTAVRKRFFESIIKEAA
RCMRRDFVKHLKKKLKRMI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser