NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14204.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14204.1 Public Homo sapiens X PHEX 20 108 85 CCDS HistoryNCBI Gene:5251Re-query CCDS DB by CCDS ID:14204.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14204.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000379374 ENSP00000368682 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379374Link to Ensembl Protein Viewer:ENSP00000368682Re-query CCDS DB by Nucleotide ID:ENST00000379374Re-query CCDS DB by Protein ID:ENSP00000368682
Original member Current member EBI,WTSI OTTHUMT00000056035 OTTHUMP00000023051 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000056035Link to Vega Protein Viewer:OTTHUMP00000023051Re-query CCDS DB by Nucleotide ID:OTTHUMT00000056035Re-query CCDS DB by Protein ID:OTTHUMP00000023051
Original member Current member NCBI NM_000444.5 NP_000435.3 Accepted alive Link to Nucleotide Sequence:NM_000444.5Link to Protein Sequence:NP_000435.3Re-query CCDS DB by Nucleotide ID:NM_000444Re-query CCDS DB by Protein ID:NP_000435Link to BLink:NP_000435.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000435.3 749 P78562 749 100% 0 0

Chromosomal Locations for CCDS 14204.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 22033006 22033123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22038469 22038537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22047050 22047211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22076388 22076474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22077476 22077702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22090429 22090497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22093983 22094099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22096955 22097038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22099006 22099151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22111467 22111560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22114458 22114586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22133523 22133624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22168312 22168389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22178273 22178376 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22190444 22190502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22212904 22212958 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22219036 22219103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22221613 22221743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22226443 22226508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22227507 22227611 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22245333 22245409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 22247851 22247953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2250 nt):
ATGGAAGCAGAAACAGGGAGCAGCGTGGAGACTGGAAAGAAGGCCAACAGAGGCACTCGAATTGCCCTGG
TC
GTGTTTGTCGGTGGCACCCTAGTTCTGGGCACGATCCTCTTTCTAGTGAGTCAAGGTCTCTTAAGTCT
C
CAAGCTAAACAGGAGTACTGCCTGAAGCCAGAATGCATCGAAGCGGCTGCTGCCATCTTAAGTAAAGTA
AAT
CTGTCTGTGGATCCTTGTGATAATTTCTTCCGGTTCGCTTGTGATGGCTGGATAAGCAATAATCCAA
TT
CCCGAAGATATGCCAAGCTATGGGGTTTATCCTTGGCTGAGACATAATGTTGACCTCAAGTTGAAGGA
A
CTTTTGGAGAAATCAATCAGTAGAAGGCGGGACACCGAAGCCATACAGAAAGCCAAAATCCTTTATTCA
TCC
TGCATGAATGAGAAAGCGATTGAAAAAGCAGATGCCAAGCCACTGCTACACATCCTACGGCATTCAC
CT
TTCCGCTGGCCCGTGCTTGAATCTAATATTGGCCCTGAAGGGGTTTGGTCAGAGAGAAAGTTCAGCCT
T
CTGCAGACACTTGCAACGTTTCGTGGTCAATACAGCAATTCTGTGTTCATCCGTTTGTATGTGTCCCCT
GAT
GACAAAGCATCCAATGAACATATCTTGAAGCTGGACCAAGCAACACTCTCCCTGGCCGTGAGGGAAG
AC
TACCTTGATAACAGTACAGAAGCCAAGTCTTATCGGGATGCCCTTTACAAGTTCATGGTGGATACTGC
C
GTGCTTTTAGGAGCTAACAGTTCCAGAGCAGAGCATGACATGAAGTCAGTGCTCAGATTGGAAATTAAG
ATA
GCTGAGATAATGATTCCACATGAAAACCGAACCAGCGAGGCCATGTACAACAAAATGAACATTTCTG
AA
CTGAGTGCTATGATTCCCCAGTTCGACTGGCTGGGCTACATCAAGAAGGTCATTGACACCAGACTCTA
C
CCCCATCTGAAAGACATCAGCCCCTCCGAGAATGTGGTGGTCCGCGTCCCGCAGTACTTTAAAGATTTG
TTT
AGGATATTAGGGTCTGAGAGAAAGAAGACCATTGCCAACTATTTGGTGTGGAGAATGGTTTATTCCA
GA
ATTCCAAACCTTAGCAGGCGCTTTCAGTATAGATGGCTGGAATTCTCAAGGGTAATCCAGGGGACCAC
A
ACTTTGCTGCCTCAATGGGACAAATGTGTAAACTTTATTGAAAGTGCCCTCCCTTATGTTGTTGGAAAG
ATG
TTTGTAGATGTGTACTTCCAGGAAGATAAGAAGGAAATGATGGAGGAATTGGTTGAGGGCGTTCGCT
GG
GCCTTTATTGACATGCTAGAGAAAGAAAATGAGTGGATGGATGCAGGAACGAAAAGGAAAGCCAAAGA
A
AAGGCGAGAGCTGTTTTGGCAAAAGTTGGCTATCCAGAGTTTATAATGAATGATACTCATGTTAATGAA
GAC
CTCAAAGCTATCAAGTTTTCAGAAGCCGACTACTTTGGCAACGTCCTACAAACTCGCAAGTATTTAG
CA
CAGTCTGATTTCTTCTGGCTAAGAAAAGCCGTTCCAAAAACAGAGTGGTTTACAAATCCGACGACTGT
C
AATGCCTTCTACAGTGCATCCACCAACCAGATCCGATTTCCAGCAGGAGAGCTCCAGAAGCCTTTCTTT
TGG
GGAACAGAATATCCTCGATCTCTGAGTTATGGTGCTATAGGAGTAATTGTCGGACATGAATTTACAC
AT
GGATTTGATAATAATGGTAGAAAATATGATAAAAATGGAAACCTGGATCCTTGGTGGTCTACTGAATC
A
GAAGAAAAGTTTAAGGAAAAAACAAAATGCATGATTAACCAGTATAGCAACTATTATTGGAAGAAAGCT
GGC
TTAAATGTCAAGGGGAAGAGGACCCTGGGAGAAAATATTGCTGATAATGGAGGCCTGCGGGAAGCTT
TT
AGGGCTTACAGGAAATGGATAAATGACAGAAGGCAGGGACTTGAGGAGCCTCTTCTACCAGGCATCAC
A
TTCACCAACAACCAGCTCTTCTTCCTGAGTTATGCTCATGTGAGGTGCAATTCCTACAGACCAGAAGCT
GCC
CGAGAACAAGTCCAAATTGGTGCTCACAGTCCCCCTCAGTTTAGGGTCAATGGTGCAATTAGTAACT
TT
GAAGAATTCCAGAAAGCTTTTAACTGTCCACCCAATTCCACGATGAACAGAGGCATGGACTCCTGCCG
A
CTCTGGTAG


Translation (749 aa):
MEAETGSSVETGKKANRGTRIALVVFVGGTLVLGTILFLVSQGLLSLQAKQEYCLKPECIEAAAAILSKV
N
LSVDPCDNFFRFACDGWISNNPIPEDMPSYGVYPWLRHNVDLKLK
ELLEKSISRRRDTEAIQKAKILYS
S
CMNE
KAIEKADAKPLLHILRHSPFRWPVLESNIGPEGVWSERKFSLLQTLATFRGQYSNSVFIRLYVSP
D
DKASNEHILK
LDQATLSLAVREDYLDNSTEAKSYRDALYKFMVDTAVLLGANSSRAEHDMKSVLRLEIK
I
AE
IMIPHENRTSEAMYNKMNISELSAMIPQFDWLGYIKKVIDTRLYPHLKDISPSENVVVRVPQYFKDL
F
RILGSERK
KTIANYLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCVNFIESALPYVVGK
M
FVDVYFQEDKKEM
MEELVEGVRWAFIDMLEKENEWMDAGTKRKAKEKARAVLAKVGYPEFIMNDTHVNE
D
LKA
IKFSEADYFGNVLQTRKYLAQSDFFWLRKAVPKTEWFTNPTTVNAFYSASTNQIRFPAGELQKPFF
W
GTEYP
RSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSTESEEKFKEKTKCMINQYSNYYWKKA
G
LN
VKGKRTLGENIADNGGLREAFRAYRKWINDRRQGLEEPLLPGITFTNNQLFFLSYAHVRCNSYRPEA
A
REQVQIGAHSPPQF
RVNGAISNFEEFQKAFNCPPNSTMNRGMDSCRLW



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser