NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30142.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30142.1 Public Mus musculus X Gm773 21 106 86 CCDS HistoryNCBI Gene:331416Re-query CCDS DB by CCDS ID:30142.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 30142.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101561 ENSMUSP00000099097 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101561Link to Ensembl Protein Viewer:ENSMUSP00000099097Re-query CCDS DB by Nucleotide ID:ENSMUST00000101561Re-query CCDS DB by Protein ID:ENSMUSP00000099097
Original member Current member EBI,WTSI OTTMUST00000042483 OTTMUSP00000019163 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042483Link to Vega Protein Viewer:OTTMUSP00000019163Re-query CCDS DB by Nucleotide ID:OTTMUST00000042483Re-query CCDS DB by Protein ID:OTTMUSP00000019163
Original member Current member NCBI NM_001033423.2 NP_001028595.1 Accepted alive Link to Nucleotide Sequence:NM_001033423.2Link to Protein Sequence:NP_001028595.1Re-query CCDS DB by Nucleotide ID:NM_001033423Re-query CCDS DB by Protein ID:NP_001028595Link to BLAST:NP_001028595.1

Chromosomal Locations for CCDS 30142.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 56190065 56190169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56193653 56193751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56196571 56196670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56197474 56197591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56201584 56201618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56202007 56202076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 56202673 56202766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (621 nt):
ATGGACAATAGGAAGCACTTCTCAGTCTATAACCTTGATGATGGTGAAGAAGAGGATGATGTTCTGGAGT
AT
TCAGCACACTCTACACTTACAGCAAGAAGCCTAGTATTTAGTAATACTGAGAAGGCATTGGTTCCTAC
A
AGAATGGGTGGTACAGATACAAGAAATGAAGTAAAGAATAGGATGGAAAACATTGGAGCTCACCTTAGC
AGT
GCTGTTGTTGAAAAGAAAAGGAGGATGGAGTCATATATTAAAGATGTTGTCAAAGATTGTGACAAGC
AT
ATCAAACAACATTGGAAAGTTCATCAAGATGAAGTACGGGAGTTTAAAATTGAATATACTGAGCAGAT
T
ATAACTCTGTTTCAGCAGTGGGATTTTGATATGAAGAATGTTGAAGACCTTGAAGATAACCTAACTAGT
GCC
TTTTGTCAGCAACAGAAGACTTTTCCACAAACCACATCACGGCAGGTCCACAGCCTGAAAGCACTTA
AG
CAGGCAAATGACACGCTCTTAAAGGGTATGGAGAACTTGGACAAAGACAATAGCAGTGTACTTTCTAG
T
ATTCACAGTGAGTTTAAAAAGCAAATGGCTTTCCTGGAAAGAAAATTGACAGATGGTTAA


Translation (206 aa):
MDNRKHFSVYNLDDGEEEDDVLEYSAHSTLTARSLVFSNTEKALVPTRMGGTDTRNEVKNRMENIGAHLS
S
AVVEKKRRMESYIKDVVKDCDKHIKQHWKVHQDE
VREFKIEYTEQIITLFQQWDFDMKNVEDLEDNLTS
A
FCQQQKTFPQTTSRQVHSLKALKQANDTLLK
GMENLDKDNSSVLSSIHSEFKKQMAFLERKLTDG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser