NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8662.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8662.1 Public Homo sapiens 12 GRIN2B 20 108 85 CCDS HistoryNCBI Gene:2904Re-query CCDS DB by CCDS ID:8662.1See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8662.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000609686 ENSP00000477455 Accepted alive Link to Ensembl Transcript Viewer:ENST00000609686Link to Ensembl Protein Viewer:ENSP00000477455Re-query CCDS DB by Nucleotide ID:ENST00000609686Re-query CCDS DB by Protein ID:ENSP00000477455
Original member Current member EBI,WTSI OTTHUMT00000268014 OTTHUMP00000174410 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000268014Link to Vega Protein Viewer:OTTHUMP00000174410Re-query CCDS DB by Nucleotide ID:OTTHUMT00000268014Re-query CCDS DB by Protein ID:OTTHUMP00000174410
Original member NCBI NM_000834.3 NP_000825.2 Updated not alive Link to Nucleotide Sequence:NM_000834.3Link to Protein Sequence:NP_000825.2Re-query CCDS DB by Nucleotide ID:NM_000834Re-query CCDS DB by Protein ID:NP_000825
Current member NCBI NM_000834.4 NP_000825.2 Accepted alive Link to Nucleotide Sequence:NM_000834.4Link to Protein Sequence:NP_000825.2Re-query CCDS DB by Nucleotide ID:NM_000834Re-query CCDS DB by Protein ID:NP_000825Link to BLink:NP_000825.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000825.2 1484 Q13224 1484 100% 0 0

Chromosomal Locations for CCDS 8662.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 13562783 13564639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13567025 13567263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13569830 13570017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13571804 13571964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13608603 13608832 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13611725 13611850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13615114 13615267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13615493 13615664 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13616455 13616657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13675745 13675859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13753317 13753915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 13865798 13866208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4455 nt):
ATGAAGCCCAGAGCGGAGTGCTGTTCTCCCAAGTTCTGGTTGGTGTTGGCCGTCCTGGCCGTGTCAGGCA
GC
AGAGCTCGTTCTCAGAAGAGCCCCCCCAGCATTGGCATTGCTGTCATCCTCGTGGGCACTTCCGACGA
G
GTGGCCATCAAGGATGCCCACGAGAAAGATGATTTCCACCATCTCTCCGTGGTACCCCGGGTGGAACTG
GTA
GCCATGAATGAGACCGACCCAAAGAGCATCATCACCCGCATCTGTGATCTCATGTCTGACCGGAAGA
TC
CAGGGGGTGGTGTTTGCTGATGACACAGACCAGGAAGCCATCGCCCAGATCCTCGATTTCATTTCAGC
A
CAGACTCTCACCCCCATCCTGGGCATCCACGGGGGCTCCTCTATGATAATGGCAGATAAGGATGAATCC
TCC
ATGTTCTTCCAGTTTGGCCCATCAATTGAACAGCAAGCTTCCGTAATGCTCAACATCATGGAAGAAT
AT
GACTGGTACATCTTTTCTATCGTCACCACCTATTTCCCTGGCTACCAGGACTTTGTAAACAAGATCCG
C
AGCACCATTGAGAATAGCTTTGTGGGCTGGGAGCTAGAGGAGGTCCTCCTACTGGACATGTCCCTGGAC
GAT
GGAGATTCTAAGATCCAGAATCAGCTCAAGAAACTTCAAAGCCCCATCATTCTTCTTTACTGTACCA
AG
GAAGAAGCCACCTACATCTTTGAAGTGGCCAACTCAGTAGGGCTGACTGGCTATGGCTACACGTGGAT
C
GTGCCCAGTCTGGTGGCAGGGGATACAGACACAGTGCCTGCGGAGTTCCCCACTGGGCTCATCTCTGTA
TCA
TATGATGAATGGGACTATGGCCTCCCCGCCAGAGTGAGAGATGGAATTGCCATAATCACCACTGCTG
CT
TCTGACATGCTGTCTGAGCACAGCTTCATCCCTGAGCCCAAAAGCAGTTGTTACAACACCCACGAGAA
G
AGAATCTACCAGTCCAATATGCTAAATAGGTATCTGATCAATGTCACTTTTGAGGGGAGGAATTTGTCC
TTC
AGTGAAGATGGCTACCAGATGCACCCGAAACTGGTGATAATTCTTCTGAACAAGGAGAGGAAGTGGG
AA
AGGGTGGGGAAGTGGAAAGACAAGTCCCTGCAGATGAAGTACTATGTGTGGCCCCGAATGTGTCCAGA
G
ACTGAAGAGCAGGAGGATGACCATCTGAGCATTGTGACCCTGGAGGAGGCACCATTTGTCATTGTGGAA
AGT
GTGGACCCTCTGAGTGGAACCTGCATGAGGAACACAGTCCCCTGCCAAAAACGCATAGTCACTGAGA
AT
AAAACAGACGAGGAGCCGGGTTACATCAAAAAATGCTGCAAGGGGTTCTGTATTGACATCCTTAAGAA
A
ATTTCTAAATCTGTGAAGTTCACCTATGACCTTTACCTGGTTACCAATGGCAAGCATGGGAAGAAAATC
AAT
GGAACCTGGAATGGTATGATTGGAGAGGTGGTCATGAAGAGGGCCTACATGGCAGTGGGCTCACTCA
CC
ATCAATGAGGAACGATCGGAGGTGGTCGACTTCTCTGTGCCCTTCATAGAGACAGGCATCAGTGTCAT
G
GTGTCACGCAGCAATGGGACTGTCTCACCTTCTGCCTTCTTAGAGCCATTCAGCGCTGACGTATGGGTG
ATG
ATGTTTGTGATGCTGCTCATCGTCTCAGCCGTGGCTGTCTTTGTCTTTGAGTACTTCAGCCCTGTGG
GT
TATAACAGGTGCCTCGCTGATGGCAGAGAGCCTGGTGGACCCTCTTTCACCATCGGCAAAGCTATTTG
G
TTGCTCTGGGGTCTGGTGTTTAACAACTCCGTACCTGTGCAGAACCCAAAGGGGACCACCTCCAAGATC
ATG
GTGTCAGTGTGGGCCTTCTTTGCTGTCATCTTCCTGGCCAGCTACACTGCCAACTTAGCTGCCTTCA
TG
ATCCAAGAGGAATATGTGGACCAGGTTTCTGGCCTGAGCGACAAAAAGTTCCAGAGACCTAATGACTT
C
TCACCCCCTTTCCGCTTTGGGACCGTGCCCAACGGCAGCACAGAGAGAAATATTCGCAATAACTATGCA
GAA
ATGCATGCCTACATGGGAAAGTTCAACCAGAGGGGTGTAGATGATGCATTGCTCTCCCTGAAAACAG
G
G
AAACTGGATGCCTTCATCTATGATGCAGCAGTGCTGAACTATATGGCAGGCAGAGATGAAGGCTGCAA
G
CTGGTGACCATTGGCAGTGGGAAGGTCTTTGCTTCCACTGGCTATGGCATTGCCATCCAAAAAGATTCT
GGG
TGGAAGCGCCAGGTGGACCTTGCTATCCTGCAGCTCTTTGGAGATGGGGAGATGGAAGAACTGGAAG
CT
CTCTGGCTCACTGGCATTTGTCACAATGAGAAGAATGAGGTCATGAGCAGCCAGCTGGACATTGACAA
C
ATGGCAGGGGTCTTCTACATGTTGGGGGCGGCCATGGCTCTCAGCCTCATCACCTTCATCTGCGAACAC
CTT
TTCTATTGGCAGTTCCGACATTGCTTTATGGGTGTCTGTTCTGGCAAGCCTGGCATGGTCTTCTCCA
TC
AGCAGAGGTATCTACAGCTGCATCCATGGGGTGGCGATCGAGGAGCGCCAGTCTGTAATGAACTCCCC
C
ACCGCAACCATGAACAACACACACTCCAACATCCTGCGCCTGCTGCGCACGGCCAAGAACATGGCTAAC
CTG
TCTGGTGTGAATGGCTCACCGCAGAGCGCCCTGGACTTCATCCGACGGGAGTCATCCGTCTATGACA
TC
TCAGAGCACCGCCGCAGCTTCACGCATTCTGACTGCAAATCCTACAACAACCCGCCCTGTGAGGAGAA
C
CTCTTCAGTGACTACATCAGTGAGGTAGAGAGAACGTTCGGGAACCTGCAGCTGAAGGACAGCAACGTG
TAC
CAAGATCACTACCACCATCACCACCGGCCCCATAGTATTGGCAGTGCCAGCTCCATCGATGGGCTCT
AC
GACTGTGACAACCCACCCTTCACCACCCAGTCCAGGTCCATCAGCAAGAAGCCCCTGGACATCGGCCT
C
CCCTCCTCCAAGCACAGCCAGCTCAGTGACCTGTACGGCAAATTCTCCTTCAAGAGCGACCGCTACAGT
GGC
CACGACGACTTGATCCGCTCCGATGTCTCTGACATCTCAACCCACACCGTCACCTATGGGAACATCG
AG
GGCAATGCCGCCAAGAGGCGTAAGCAGCAATATAAGGACAGCCTGAAGAAGCGGCCTGCCTCGGCCAA
G
TCCCGCAGGGAGTTTGACGAGATCGAGCTGGCCTACCGTCGCCGACCGCCCCGCTCCCCTGACCACAAG
CGC
TACTTCAGGGACAAGGAAGGGCTACGGGACTTCTACCTGGACCAGTTCCGAACAAAGGAGAACTCAC
CC
CACTGGGAGCACGTAGACCTGACCGACATCTACAAGGAGCGGAGTGATGACTTTAAGCGCGACTCCGT
C
AGCGGAGGAGGGCCCTGTACCAACAGGTCTCACATCAAGCACGGGACGGGCGACAAACACGGCGTGGTC
AGC
GGGGTACCTGCACCTTGGGAGAAGAACCTGACCAACGTGGAGTGGGAGGACCGGTCCGGGGGCAACT
TC
TGCCGCAGCTGTCCCTCCAAGCTGCACAACTACTCCACGACGGTGACGGGTCAGAACTCGGGCAGGCA
G
GCGTGCATCCGGTGTGAGGCTTGCAAGAAAGCAGGCAACCTGTATGACATCAGTGAGGACAACTCCCTG
CAG
GAACTGGACCAGCCGGCTGCCCCAGTGGCGGTGACGTCAAACGCCTCCACCACTAAGTACCCTCAGA
GC
CCGACTAATTCCAAGGCCCAGAAGAAGAACCGGAACAAACTGCGCCGGCAGCACTCCTACGACACCTT
C
GTGGACCTGCAGAAGGAAGAAGCCGCCCTGGCCCCGCGCAGCGTAAGCCTGAAAGACAAGGGCCGATTC
ATG
GATGGGAGCCCCTACGCCCACATGTTTGAGATGTCAGCTGGCGAGAGCACCTTTGCCAACAACAAGT
CC
TCAGTGCCCACTGCCGGACATCACCACCACAACAACCCCGGCGGCGGGTACATGCTCAGCAAGTCGCT
C
TACCCTGACCGGGTCACGCAAAACCCTTTCATCCCCACTTTTGGGGACGACCAGTGCTTGCTCCATGGC
AGC
AAATCCTACTTCTTCAGGCAGCCCACGGTGGCGGGGGCGTCGAAAGCCAGGCCGGACTTCCGGGCCC
TT
GTCACCAACAAGCCGGTGGTCTCGGCCCTTCATGGGGCCGTGCCAGCCCGTTTCCAGAAGGACATCTG
T
ATAGGGAACCAGTCCAACCCCTGTGTGCCTAACAACAAAAACCCCAGGGCTTTCAATGGCTCCAGCAAT
GGG
CATGTTTATGAGAAACTTTCTAGTATTGAGTCTGATGTCTGA


Translation (1484 aa):
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVEL
V
AMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADK
DES
S
MFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLD
D
GDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVPAEFPTGLISV
S
YDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLN
RYLINVTFEGRNLS
F
SEDGYQMHPKLVIILLNKERKWER
VGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
S
VDPLSGTCMRNTVPCQKRIVT
ENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKI
N
GTWNGMIGE
VVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWV
M
MFVMLLIVSAVAVFVFEYFSPVGYNRCLADGR
EPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKI
M
VSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKK
FQRPNDFSPPFRFGTVPNGSTERNIRNNYA
E
MHAYMGKFNQRGVDDALLSLKT
GKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDS
G
WKRQVDLAILQLFGD
GEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
L
FYWQFRHCFMGVCSGKPGMVFSISR
GIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMAN
L
SGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKDSNV
Y
QDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQSRSISKKPLDIGLPSSKHSQLSDLYGKFSFKSDRYS
G
HDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHK
R
YFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHIKHGTGDKHGVV
S
GVPAPWEKNLTNVEWEDRSGGNFCRSCPSKLHNYSTTVTGQNSGRQACIRCEACKKAGNLYDISEDNSL
Q
ELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRF
M
DGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHG
S
KSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPARFQKDICIGNQSNPCVPNNKNPRAFNGSSN
G
HVYEKLSSIESDV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser