NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9030.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9030.1 Public Homo sapiens 12 MGAT4C 20 108 85 CCDS HistoryNCBI Gene:25834Re-query CCDS DB by CCDS ID:9030.1See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9030.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000552808 ENSP00000446647 Accepted alive Link to Ensembl Transcript Viewer:ENST00000552808Link to Ensembl Protein Viewer:ENSP00000446647Re-query CCDS DB by Nucleotide ID:ENST00000552808Re-query CCDS DB by Protein ID:ENSP00000446647
Original member Current member EBI,WTSI ENST00000548651 ENSP00000447253 Accepted alive Link to Ensembl Transcript Viewer:ENST00000548651Link to Ensembl Protein Viewer:ENSP00000447253Re-query CCDS DB by Nucleotide ID:ENST00000548651Re-query CCDS DB by Protein ID:ENSP00000447253
Original member Current member EBI,WTSI ENST00000620241 ENSP00000477650 Accepted alive Link to Ensembl Transcript Viewer:ENST00000620241Link to Ensembl Protein Viewer:ENSP00000477650Re-query CCDS DB by Nucleotide ID:ENST00000620241Re-query CCDS DB by Protein ID:ENSP00000477650
Original member Current member EBI,WTSI ENST00000621808 ENSP00000478300 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621808Link to Ensembl Protein Viewer:ENSP00000478300Re-query CCDS DB by Nucleotide ID:ENST00000621808Re-query CCDS DB by Protein ID:ENSP00000478300
Original member Current member EBI,WTSI ENST00000611864 ENSP00000481096 Accepted alive Link to Ensembl Transcript Viewer:ENST00000611864Link to Ensembl Protein Viewer:ENSP00000481096Re-query CCDS DB by Nucleotide ID:ENST00000611864Re-query CCDS DB by Protein ID:ENSP00000481096
Original member Current member EBI,WTSI OTTHUMT00000406215 OTTHUMP00000242279 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000406215Link to Vega Protein Viewer:OTTHUMP00000242279Re-query CCDS DB by Nucleotide ID:OTTHUMT00000406215Re-query CCDS DB by Protein ID:OTTHUMP00000242279
Original member Current member EBI,WTSI OTTHUMT00000406216 OTTHUMP00000276093 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000406216Link to Vega Protein Viewer:OTTHUMP00000276093Re-query CCDS DB by Nucleotide ID:OTTHUMT00000406216Re-query CCDS DB by Protein ID:OTTHUMP00000276093
Original member Current member EBI,WTSI OTTHUMT00000406212 OTTHUMP00000276094 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000406212Link to Vega Protein Viewer:OTTHUMP00000276094Re-query CCDS DB by Nucleotide ID:OTTHUMT00000406212Re-query CCDS DB by Protein ID:OTTHUMP00000276094
Original member Current member EBI,WTSI OTTHUMT00000406225 OTTHUMP00000276095 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000406225Link to Vega Protein Viewer:OTTHUMP00000276095Re-query CCDS DB by Nucleotide ID:OTTHUMT00000406225Re-query CCDS DB by Protein ID:OTTHUMP00000276095
Original member NCBI NM_013244.3 NP_037376.2 Updated not alive Link to Nucleotide Sequence:NM_013244.3Link to Protein Sequence:NP_037376.2Re-query CCDS DB by Nucleotide ID:NM_013244Re-query CCDS DB by Protein ID:NP_037376
Current member NCBI NM_013244.4 NP_037376.2 Accepted alive Link to Nucleotide Sequence:NM_013244.4Link to Protein Sequence:NP_037376.2Re-query CCDS DB by Nucleotide ID:NM_013244Re-query CCDS DB by Protein ID:NP_037376Link to BLAST:NP_037376.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_037376.2 478 Q9UBM8-1 478 100% 0 0

Chromosomal Locations for CCDS 9030.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 85979289 85980430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 85983523 85983670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 85989400 85989546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1437 nt):
ATGTTTAAATTTCATCAAATGAAACATATTTTTGAAATACTTGATAAAATGAGATGCCTGAGAAAACGTT
CT
ACAGTGTCATTCTTGGGAGTTCTTGTCATTTTTCTCCTTTTTATGAACTTGTACATTGAAGATAGCTA
T
GTTCTGGAAGGAGACAAACAACTTATAAGGGAAACATCCACACATCAACTGAATTCAGAACGCTATGTT
CAT
ACTTTCAAGGATTTATCTAATTTCTCAGGAGCCATAAATGTCACCTATCGCTACCTAGCTGCCACAC
CT
TTACAAAGAAAGCGGTATCTTACAATTGGACTTTCTTCAGTAAAGCGAAAAAAAGGAAACTATTTACT
T
GAGACAATTAAGTCAATTTTTGAGCAATCCAGCTATGAAGAGCTGAAGGAAATTTCAGTGGTGGTTCAC
CTA
GCAGACTTTAATTCTTCCTGGCGTGATGCCATGGTCCAGGATATTACACAGAAATTTGCGCACCATA
TT
ATTGCAGGAAGATTAATGGTTATACATGCTCCAGAGGAGTATTACCCAATCCTAGATGGCCTTAAAAG
A
AATTACAATGATCCAGAAGATAGAGTCAAATTTCGTTCCAAGCAAAATGTAGATTATGCTTTTCTGCTT
AAT
TTTTGTGCCAATACTTCAGACTATTATGTAATGCTTGAAGATGATGTTCGATGTTCAAAAAATTTCT
TA
ACTGCCATCAAGAAAGTCATTGCATCCCTAGAAGGAACTTACTGGGTAACTCTTGAATTCTCTAAGCT
T
GGCTACATTGGTAAACTCTATCATTCTCATGATCTCCCACGTTTGGCCCATTTTTTATTAATGTTTTAT
CAA
GAAATGCCTTGTGATTGGCTATTGACTCATTTCCGTGGTCTGTTGGCTCAGAAAAATGTGATCCGTT
TT
AAACCATCTCTCTTTCAGCACATGGGCTATTATTCATCATACAAAGGGACGGAGAATAAGCTGAAGGA
T
GATGATTTTGAAGAGGAGTCATTTGACATTCCTGATAACCCCCCTGCAAGTCTGTACACCAACATGAAT
GTG
TTTGAAAATTATGAAGCAAGCAAGGCTTACAGTAGTGTTGATGAGTACTTTTGGGGGAAACCACCTT
CA
ACAGGAGATGTTTTTGTGATTGTATTTGAAAATCCAATTATAATAAAAAAAATTAAAGTAAATACTGG
A
ACAGAAGATCGGCAAAATGATATTTTGCATCATGGAGCCCTAGATGTTGGGGAAAACGTTATGCCTAGC
AAA
CAAAGGAGACAATGTTCTACTTACTTAAGACTAGGAGAATTCAAAAATGGAAACTTTGAAATGTCAG
GT
GTAAATCAAAAAATTCCATTTGATATACATTGTATGAGGATATATGTCACCAAAACACAAAAGGAATG
G
CTAATTATTAGGAGTATTAGCATTTGGACTTCTTAG


Translation (478 aa):
MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETSTHQLNSERYV
H
TFKDLSNFSGAINVTYRYLAATPLQRK
RYLTIGLSSVKRKKGNYLLETIKSIFEQSSYEELKEISVVVH
L
ADFNSSWRDAMVQDITQKFAHHIIAGRLMVIHAPEEYYPILDGLKRNYNDPEDRVKFRSKQNVDYAFLL
N
FCANTSDYYVMLEDDVRCSKNFLTAIKKVIASLEGTYWVTLEFSKLGYIGKLYHSHDLPRLAHFLLMFY
Q
EMPCDWLLTHFRGLLAQKNVIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMN
V
FENYEASKAYSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPS
K
QRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser