NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21355.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21355.1 Public Mus musculus 7 Igf1r 21 106 86 CCDS HistoryNCBI Gene:16001Re-query CCDS DB by CCDS ID:21355.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21355.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000005671 ENSMUSP00000005671 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005671Link to Ensembl Protein Viewer:ENSMUSP00000005671Re-query CCDS DB by Nucleotide ID:ENSMUST00000005671Re-query CCDS DB by Protein ID:ENSMUSP00000005671
Original member Current member EBI,WTSI OTTMUST00000146160 OTTMUSP00000076144 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000146160Link to Vega Protein Viewer:OTTMUSP00000076144Re-query CCDS DB by Nucleotide ID:OTTMUST00000146160Re-query CCDS DB by Protein ID:OTTMUSP00000076144
Original member Current member NCBI NM_010513.2 NP_034643.2 Accepted alive Link to Nucleotide Sequence:NM_010513.2Link to Protein Sequence:NP_034643.2Re-query CCDS DB by Nucleotide ID:NM_010513Re-query CCDS DB by Protein ID:NP_034643Link to BLAST:NP_034643.2

Chromosomal Locations for CCDS 21355.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 67952859 67952952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68003810 68004355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68164993 68165305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68169897 68170048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68173231 68173375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68183344 68183558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68184731 68184857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68186990 68187228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68189573 68189740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68189946 68190150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68193347 68193630 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68194969 68195105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68195590 68195749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68201244 68201346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68201902 68201972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68207251 68207480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68207763 68207873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68211994 68212156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68214919 68215048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68218402 68218536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 68226020 68226401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4110 nt):
ATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGCTGTGGGGGCTCGTGTTTCTCTCCGCCGCGCTCT
CT
CTCTGGCCGACGAGTGGAGAAATCTGTGGGCCCGGCATTGACATCCGCAACGACTATCAGCAGCTGAA
G
CGCCTGGAAAACTGCACGGTGATCGAGGGCTTCCTCCACATCCTGCTCATCTCCAAGGCCGAGGACTAC
CGA
AGCTACCGCTTCCCCAAGCTCACCGTCATCACTGAGTACTTGCTGCTCTTCCGAGTCGCTGGCCTCG
AG
AGCCTGGGAGACCTCTTCCCCAACCTCACAGTCATCCGTGGCTGGAAACTCTTCTACAACTACGCACT
G
GTCATCTTCGAGATGACCAATCTCAAGGATATTGGGCTTTATAATCTGAGGAACATTACTCGGGGGGCC
ATC
AGGATTGAGAAGAACGCCGACCTCTGTTACCTCTCCACCATAGACTGGTCTCTCATCTTGGATGCGG
TG
TCCAATAACTACATTGTGGGGAACAAGCCCCCGAAGGAATGTGGGGACCTGTGTCCAGGGACATTGGA
G
GAGAAGCCCATGTGTGAGAAGACCACCATCAACAATGAGTACAACTACCGCTGCTGGACCACAAATCGC
TGC
CAGAAAATGTGCCCAAGTGTGTGCGGGAAGCGAGCCTGCACCGAGAACAACGAGTGCTGCCACCCGG
AG
TGCCTGGGCAGCTGCCACACACCGGACGACAACACAACCTGCGTGGCCTGCAGACACTACTACTACAA
A
GGCGTGTGTGTGCCTGCCTGCCCGCCTGGCACCTACAGGTTCGAGGGCTGGCGCTGTGTGGATCGCGAT
TTC
TGCGCCAACATCCCCAACGCTGAGAGCAGTGACTCGGATGGCTTCGTTATCCACGACGATGAGTGCA
TG
CAGGAGTGTCCCTCAGGCTTCATCCGCAACAGCACCCAGAGCATGTACTGTATCCCCTGCGAAGGCCC
C
TGCCCCAAAGTCTGCGGCGATGAAGAGAAGAAAACGAAAACCATCGATTCGGTGACTTCTGCTCAAATG
CTC
CAAGGATGCACCATCCTGAAGGGCAATCTGCTTATTAACATCCGGAGAGGCAATAACATTGCCTCGG
AG
TTGGAGAACTTCATGGGGCTCATCGAGGTGGTGACCGGCTACGTGAAGATCCGCCATTCTCATGCCTT
G
GTCTCCTTGTCCTTCCTGAAGAACCTTCGTCTCATCTTAGGAGAGGAGCAGCTGGAAGGGAACTACTCC
TTC
TATGTCCTAGACAACCAGAACTTGCAGCAGCTGTGGGACTGGAACCACCGGAACCTGACCGTCAGGT
CC
GGAAAGATGTACTTTGCTTTCAATCCCAAGCTGTGTGTCTCCGAAATTTACCGCATGGAGGAAGTGAC
C
GGAACCAAGGGACGCCAGAGCAAAGGGGACATAAACACCAGGAACAACGGAGAGCGAGCTTCCTGTGAA
AGT
GATGTTCTCCGTTTCACCTCCACCACGACCTGGAAGAACCGAATCATCATAACGTGGCACCGGTACC
GG
CCGCCGGACTACCGGGATCTCATCAGCTTCACAGTTTACTACAAGGAGGCACCATTTAAAAACGTTAC
G
GAATATGACGGGCAGGATGCCTGTGGCTCCAACAGCTGGAACATGGTGGATGTAGACCTGCCTCCGAAC
AAG
GAGGGCGAGCCTGGCATTTTACTGCATGGGCTGAAGCCCTGGACCCAGTATGCTGTCTATGTCAAGG
CT
GTGACCCTCACCATGGTGGAAAACGACCATATCCGTGGGGCCAAAAGTGAAATCTTGTACATTCGCAC
C
AATGCTTCAGTCCCTTCCATTCCCCTAGATGTCCTCTCAGCATCAAACTCTTCCTCTCAGCTGATTGTG
AAG
TGGAATCCTCCAACTCTGCCCAATGGTAACTTGAGTTACTACATTGTGAGGTGGCAGCGGCAGCCCC
AG
GATGGTTACCTGTACCGGCACAACTACTGCTCCAAAGACAAAATACCCATCAGAAAGTACGCCGATGG
T
ACCATCGACGTGGAGGAGGTGACGGAAAATCCCAAGACAGAAGTGTGTGGTGGTGATAAAGGGCCATGC
TGC
GCTTGCCCTAAAACTGAAGCTGAGAAGCAGGCTGAGAAGGAGGAGGCTGAGTACCGTAAAGTCTTTG
AG
AATTTCCTTCACAATTCCATCTTTGTGCCCAGGCCCGAAAGGAGGCGGAGAGACGTCATGCAAGTGGC
C
AACACGACCATGTCCAGCCGAAGCAGGAACACCACGGTAGCTGACACCTACAATATCACAGACCCGGAG
GAG
TTCGAGACAGAGTACCCTTTCTTTGAGAGCAGAGTGGATAACAAGGAGAGGACTGTCATCTCCAACC
TC
CGGCCTTTCACTCTGTACCGCATCGATATCCACAGCTGCAACCACGAGGCTGAGAAGCTGGGCTGCAG
C
GCCTCCAACTTCGTCTTTGCGAGAACCATGCCAGCAGAAGGAGCAGATGATATCCCTGGTCCGGTGACC
TGG
GAGCCAAGACCCGAAAACTCCATCTTTTTAAAGTGGCCAGAACCCGAGAACCCCAACGGATTGATCC
TA
ATGTATGAAATTAAATACGGGTCGCAAGTCGAGGATCAGCGGGAATGTGTGTCCAGACAGGAGTACAG
G
AAGTACGGAGGGGCCAAACTCAACCGTCTAAACCCAGGGAACTATACAGCCCGGATTCAGGCTACCTCC
CTC
TCTGGGAATGGGTCATGGACAGATCCTGTGTTCTTCTATGTCCCCGCCAAAACGACGTATGAGAACT
TC
ATGCATCTGATCATTGCTCTGCCGGTTGCCATCCTGCTGATCGTTGGGGGGCTGGTTATCATGCTGTA
T
GTCTTCCATAGAAAGAGAAATAACAGCAGGTTGGGCAATGGAGTGCTGTATGCTTCTGTGAACCCCGAG
TAT
TTCAGCGCAGCTGATGTGTACGTGCCTGATGAATGGGAGGTAGCTCGAGAGAAGATCACCATGAACC
GG
GAGCTCGGACAAGGGTCCTTTGGGATGGTCTATGAAGGAGTGGCCAAGGGTGTGGTCAAGGATGAACC
C
GAAACCAGAGTGGCCATCAAGACGGTAAACGAGGCTGCAAGTATGCGTGAAAGAATCGAGTTTCTCAAC
GAG
GCCTCGGTGATGAAGGAGTTCAATTGTCACCATGTGGTCCGGTTGCTGGGTGTGGTATCCCAAGGCC
AG
CCCACCCTGGTCATCATGGAACTAATGACACGCGGTGATCTCAAAAGTTATCTCCGGTCTCTGAGGCC
A
GAAGTGGAGCAGAATAATCTAGTCCTCATTCCTCCGAGCTTAAGCAAGATGATCCAGATGGCTGGAGAG
ATT
GCAGATGGCATGGCCTACCTCAATGCCAACAAGTTCGTCCACAGAGACCTTGCTGCTAGGAACTGCA
TG
GTAGCCGAAGATTTCACAGTCAAAATTGGAGATTTCGGTATGACACGAGACATCTACGAGACGGACTA
C
TACCGGAAAGGCGGGAAGGGGTTGCTGCCTGTGCGCTGGATGTCTCCCGAGTCCCTCAAGGATGGTGTC
TTC
ACTACTCATTCTGATGTCTGGTCCTTCGGGGTCGTCCTCTGGGAGATCGCCACGCTGGCTGAGCAGC
CC
TACCAGGGCTTGTCCAACGAGCAAGTTCTTCGTTTCGTCATGGAGGGTGGCCTTCTGGACAAGCCGGA
C
AACTGCCCTGATATGCTGTTTGAACTTATGCGCATGTGCTGGCAGTATAACCCCAAGATGCGGCCCTCC
TTC
CTGGAGATCATCGGCAGCATCAAGGATGAGATGGAGCCCAGCTTCCAGGAGGTCTCCTTCTACTACA
GC
GAGGAGAACAAGCCTCCCGAGCCAGAGGAGCTGGAGATGGAGCCTGAGAACATGGAGAGCGTCCCACT
G
GACCCTTCGGCCTCCTCAGCCTCCCTGCCTCTGCCTGAAAGACACTCAGGACACAAGGCTGAGAATGGC
CCG
GGCCCTGGCGTGCTCGTTCTCCGCGCCAGTTTTGATGAGAGACAGCCTTACGCTCACATGAACGGGG
GA
CGCGCCAACGAGAGGGCCTTGCCTCTGCCCCAGTCCTCGACCTGCTGA


Translation (1369 aa):
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLHILLISKAEDY
R
SYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA
I
RIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGDLCPGTLEEKPMCEKTTINNEYNYRCWTTNR
C
QK
MCPSVCGKRACTENNECCHPECLGSCHTPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRD
F
CANIPNAESSDSDGFVIHDDECMQECPSGFIRNSTQ
SMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQM
L
QGCTILKGNLLINIRRG
NNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
F
YVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERAS
CE
S
DVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKE
APFKNVTEYDGQDACGSNSWNMVDVDLPPN
K
EGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNAS
VPSIPLDVLSASNSSSQLIV
K
WNPPTLPNGNLSYYIVRWQRQPQDGYLYRHNYCSK
DKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPC
C
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVP
RPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPE
E
FETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA
EGADDIPGPVT
W
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVE
DQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATS
L
SGNGSWTDPVFFYVPAK
TTYENFMHLIIALPVAILLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPE
Y
FSAAD
VYVPDEWEVAREKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLN
E
ASVMKEFNCHHV
VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGE
I
ADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGV
F
TTHSDV
WSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
F
LEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMEPENMESVPLDPSASSASLPLPERHSGHKAENG
P
GPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser