NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS30848.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30848.1 Public Homo sapiens 1 HIST2H3C 20 108 85 CCDS HistoryNCBI Gene:126961Re-query CCDS DB by CCDS ID:30848.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30848.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000369158 ENSP00000358154 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369158Link to Ensembl Protein Viewer:ENSP00000358154Re-query CCDS DB by Nucleotide ID:ENST00000369158Re-query CCDS DB by Protein ID:ENSP00000358154
Original member Current member EBI,WTSI OTTHUMT00000033697 OTTHUMP00000014041 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000033697Link to Vega Protein Viewer:OTTHUMP00000014041Re-query CCDS DB by Nucleotide ID:OTTHUMT00000033697Re-query CCDS DB by Protein ID:OTTHUMP00000014041
Original member Current member NCBI NM_021059.2 NP_066403.2 Accepted alive Link to Nucleotide Sequence:NM_021059.2Link to Protein Sequence:NP_066403.2Re-query CCDS DB by Nucleotide ID:NM_021059Re-query CCDS DB by Protein ID:NP_066403Link to BLAST:NP_066403.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_066403.2 136 Q71DI3 136 100% 0 0

Chromosomal Locations for CCDS 30848.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 149840747 149841157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (411 nt):
ATGGCCCGTACTAAGCAGACTGCTCGCAAGTCGACCGGCGGCAAGGCCCCGAGGAAGCAGCTGGCCACCA
AG
GCGGCCCGCAAGAGCGCGCCGGCCACGGGCGGGGTGAAGAAGCCGCACCGCTACCGGCCCGGCACCGT
A
GCCCTGCGGGAGATCCGGCGCTACCAGAAGTCCACGGAGCTGCTGATCCGCAAGCTGCCCTTCCAGCGG
CTG
GTACGCGAGATCGCGCAGGACTTTAAGACGGACCTGCGCTTCCAGAGCTCGGCCGTGATGGCGCTGC
AG
GAGGCCAGCGAGGCCTACCTGGTGGGGCTGTTCGAAGACACGAACCTGTGCGCCATCCACGCCAAGCG
C
GTGACCATTATGCCCAAGGACATCCAGCTGGCCCGCCGCATCCGTGGAGAGCGGGCTTAA


Translation (136 aa):
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
L
VREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser