NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30396.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30396.1 Public Mus musculus X Btk 21 106 86 CCDS HistoryNCBI Gene:12229Re-query CCDS DB by CCDS ID:30396.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30396.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033617 ENSMUSP00000033617 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033617Link to Ensembl Protein Viewer:ENSMUSP00000033617Re-query CCDS DB by Nucleotide ID:ENSMUST00000033617Re-query CCDS DB by Protein ID:ENSMUSP00000033617
Original member Current member EBI,WTSI OTTMUST00000046138 OTTMUSP00000020834 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046138Link to Vega Protein Viewer:OTTMUSP00000020834Re-query CCDS DB by Nucleotide ID:OTTMUST00000046138Re-query CCDS DB by Protein ID:OTTMUSP00000020834
Original member Current member NCBI NM_013482.2 NP_038510.2 Accepted alive Link to Nucleotide Sequence:NM_013482.2Link to Protein Sequence:NP_038510.2Re-query CCDS DB by Nucleotide ID:NM_013482Re-query CCDS DB by Protein ID:NP_038510Link to BLink:NP_038510.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038510.2 659 P35991 659 100% 0 0

Chromosomal Locations for CCDS 30396.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 134542736 134542807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134545482 134545639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134546712 134546830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134547562 134547626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134549415 134549631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134550307 134550478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134551202 134551276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134554399 134554526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134554689 134554768 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134555549 134555603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134556338 134556400 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134556788 134556975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134558687 134558754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134559198 134559326 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134565597 134565678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134568905 134568973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134573209 134573307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 134573917 134574057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1980 nt):
ATGGCTGCAGTGATACTGGAGAGCATCTTTCTGAAGCGCTCCCAGCAGAAAAAGAAAACATCACCTTTAA
AC
TTCAAGAAGCGCCTGTTTCTCTTGACTGTACACAAACTTTCATACTATGAATATGACTTTGAACGTGG
G
AGAAGAGGCAGTAAGAAAGGTTCAATAGATGTTGAGAAGATCACCTGTGTTGAAACAGTAATTCCTGAA
AAA
AATCCCCCACCAGAAAGACAGATTCCGAGGAGAGGTGAGGAGTCTAGTGAAATGGAACAGATTTCAA
TC
ATTGAAAGGTTCCCGTACCCATTCCAGGTTGTATATGATGAAGGACCTCTCTATGTTTTCTCCCCAAC
T
GAAGAGCTGAGAAAGCGCTGGATTCACCAGCTCAAAAATGTAATCCGGTACAATAGTGACCTGGTACAG
AAA
TACCATCCTTGCTTCTGGATTGATGGACAGTATCTCTGCTGCTCTCAGACAGCCAAGAATGCTATGG
GC
TGCCAAATTTTGGAGAACAGGAATGGAAGCTTAAAACCTGGGAGTTCTCATCGAAAAACGAAAAAGCC
T
CTTCCCCCTACCCCAGAGGAAGATCAGATCTTGAAAAAACCGCTTCCCCCGGAGCCAACAGCAGCACCA
ATC
TCCACAACCGAGCTGAAAAAGGTCGTGGCCCTTTATGATTACATGCCAATGAACGCAAATGACTTAC
AA
TTGCGAAAGGGCGAGGAGTATTTTATCCTGGAGGAGAGCAACCTACCGTGGTGGCGAGCACGAGATAA
A
AATGGGCAGGAAGGCTACATCCCAAGTAACTATATCACTGAAGCTGAGGACTCCATAGAGATGTATGAG
TGG
TATTCCAAGCACATGACTCGAAGTCAAGCTGAGCAACTGCTAAAGCAAGAGGGGAAAGAAGGAGGTT
TC
ATTGTCAGAGACTCCAGCAAAGCTGGAAAATACACCGTGTCTGTGTTTGCTAAATCTACTGGGGAGCC
T
CAAGGGGTGATCCGCCATTACGTTGTGTGTTCCACGCCACAGAGCCAGTATTACCTGGCTGAGAAACAC
CTC
TTCAGCACCATCCCTGAGCTCATTAACTACCATCAACACAACTCTGCAGGCCTCATATCCAGGCTGA
AA
TATCCTGTGTCTAAACAAAACAAAAACGCGCCTTCTACTGCAGGCCTGGGCTATGGATCATGGGAAAT
T
GATCCAAAGGACCTCACCTTCTTGAAGGAGCTTGGGACTGGACAATTCGGTGTCGTGAAATATGGGAAG
TGG
AGGGGCCAATATGATGTGGCCATCAAGATGATCAGAGAAGGTTCCATGTCGGAGGATGAATTCATTG
AA
GAAGCCAAAGTCATGATGAATCTTTCCCATGAGAAGCTGGTGCAGTTGTATGGCGTCTGCACCAAACA
A
CGCCCCATCTTCATCATCACCGAGTACATGGCTAATGGCTGCCTCTTGAACTACCTGAGGGAGATGCGG
CAC
CGCTTCCAGACACAGCAGCTGCTTGAGATGTGCAAAGATGTCTGTGAAGCAATGGAATACTTGGAGT
CG
AAGCAGTTCCTTCACAGAGACCTGGCAGCTCGAAACTGTTTGGTAAACGATCAAGGAGTTGTGAAAGT
A
TCTGACTTTGGCCTGTCTAGGTATGTCCTTGATGATGAGTACACCAGCTCTGTAGGCTCCAAGTTTCCA
GTC
CGGTGGTCTCCACCAGAAGTGCTTATGTATAGCAAGTTCAGCAGCAAATCTGACATCTGGGCTTTTG
GG
GTTTTAATGTGGGAGATCTACTCCCTGGGGAAGATGCCGTATGAGAGATTTACTAACAGTGAGACAGC
A
GAACACATTGCTCAAGGCTTACGTCTCTACAGGCCTCATCTGGCATCAGAGAGGGTATATACCATCATG
TAC
AGCTGCTGGCACGAGAAAGCAGATGAACGTCCTAGTTTCAAAATTCTCTTGAGTAACATTCTAGATG
TG
ATGGATGAAGAATCCTGA


Translation (659 aa):
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVIPE
K
NPPPERQIP
RRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ
K
YHPCFWIDGQYLCCSQTAKNAMGCQILENRNG
SLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAP
I
STTELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKN
GQEGYIPSNYITEAEDSIEMYE
W
YSKHMTRSQAEQLLKQE
GKEGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKH
L
FSTIPELINYHQHNSA
GLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
W
RGQYDVAIKMIREGSMSEDEFIEEAKVM
MNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR
H
RFQTQQLLEMCKDVCEAMEYLESKQFLHRDL
AARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP
V
RWSPPEVLMYSKFSSKSDIWAF
GVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIM
Y
SCWHE
KADERPSFKILLSNILDVMDEES



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser